Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

A
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

3jp1ib-1h.myshopify.com

Aura Jewels — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 1,090 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 6 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
1,090

~1,090 products on this store the last time we crawled it — not a live inventory count

Products moving this week
2

This store's listings in Market Moves · counted 30 Sept

Store age
1 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledAug 27, 2026Last crawled listingSep 28, 2026Last crawledSep 24, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is aurajewels.xyz.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

aurajewels.xyz

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Clothing Accessories

Features

FAQ PageShopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Tracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,809,346
global
Outranks
31.2%
of Shopify stores
Overall rank
#12,495,701
all platforms
Outranks
15.8%
of all tracked stores
Related domains
2
Vendors
7
Collections
53
Location
Beaumont, Americas
Subregion
Northern America
Theme
dawn (Shopify)
default · vUnknown
Storefront languages
EN
site language
Est. store created
Aug 21, 2026
SL last updated
Sep 25, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (6)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Google Ads Pixel by Nabu

Google Ads Pixel by Nabu

ads · analytics

Gaining 68 stores / 30d

EAZE Button

EAZE Button

chat · marketing - other

Meta & Facebook Pixels by Nabu

Meta & Facebook Pixels by Nabu

ads · analytics

Gaining 87 stores / 30d

Smind Sections: Theme Sections

Smind Sections: Theme Sections

page builder · upsell and cross-sell

Losing 40 stores / 30d

EAZE WhatsApp Button

EAZE WhatsApp Button

chat · marketing - other

Gaining 188 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayPayPal Express CheckoutShop Pay

Quick answers about Aura Jewels

Figures are estimates from public data — never exact sales or revenue.

Is Aura Jewels a dropshipping store?
Possibly. 3jp1ib-1h.myshopify.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Aura Jewels sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Aura Jewels sell?
3jp1ib-1h.myshopify.com lists about 1,090 products in Apparel › Clothing Accessories. Its likely best sellers are [AuraJewelry] CLOVER LARGE (20mm) 1 MOTIFS WHITE MOP STUD EARRINGS, [AuraJewelry] 2026 NEW MODEL SPRING LUCKY BROOCH and [AuraJewelry] 2026 NEW LUCKY SPRING EARRINGS.
What apps does Aura Jewels use?
WHAT Shipping? found 6 apps on 3jp1ib-1h.myshopify.com, including 17TRACK Order Tracking, Google Ads Pixel by Nabu, EAZE Button, Meta & Facebook Pixels by Nabu and Smind Sections: Theme Sections.
How old is Aura Jewels?
3jp1ib-1h.myshopify.com was created around Aug 21, 2026, about 1 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0