Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

V
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

authenticviontari.com

Viontari — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 163 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 4 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
163

~163 products on this store the last time we crawled it — not a live inventory count

Store age
2 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledAug 12, 2026Last crawled listingSep 28, 2026Last crawledSep 26, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

authenticget.comviontari.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.authenticviontari.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Footwear

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,507,320
global
Outranks
38.6%
of Shopify stores
Overall rank
#11,323,723
all platforms
Outranks
23.7%
of all tracked stores
Related domains
1
Vendors
1
Collections
9
Location
Cheyenne, Americas
Subregion
Northern America
Theme
prestige (Maestrooo)
Signature · vUnknown · $400 theme
Storefront languages
EN
site language
Est. store created
Jul 10, 2026
SL last updated
Sep 25, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (5)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

BK Reviews

BK Reviews

product reviews

Losing 221 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Kaching Bundles App & Upsells

Kaching Bundles App & Upsells

product bundles · upsell and cross-sell

Gaining 4,147 stores / 30d

iCart Cart Drawer Cart Upsell

iCart Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 4,006 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle PayNext.jsPinterest PixelShop PaySnap PixelTikTok PixelVimeoYouTube Player

Quick answers about Viontari

Figures are estimates from public data — never exact sales or revenue.

Is Viontari a dropshipping store?
Possibly. authenticviontari.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Viontari sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Viontari sell?
authenticviontari.com lists about 163 products in Apparel › Footwear. Its likely best sellers are Submariner 126619LB - Luxury Watch with Ceramic Bezel, Waterproof Bomber Jacket - (60% OFF SALE) and Datejust Black Dial 41mm 126334.
What apps does Viontari use?
WHAT Shipping? found 5 apps on authenticviontari.com, including 17TRACK Order Tracking, BK Reviews, BUCKS Currency Converter PRO++, Kaching Bundles App & Upsells and iCart Cart Drawer Cart Upsell.
How old is Viontari?
authenticviontari.com was created around Jul 10, 2026, about 2 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0