Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

A
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

auvrasupplements.com

Auvra Supplements — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated 1K–5K monthly traffic, 8 products in the crawled catalogue.

Store catalogue last scanned 3 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$436 – $2K

Estimated monthly

Est. yearly sales
$478 – $887

Estimated annualized

Products detected
8

~8 products on this store the last time we crawled it — not a live inventory count

Store age
11 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Synctrack

PayPal tracking sync

+5

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

auvramx.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.auvrasupplements.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Health › Nutrition › Vitamins & Supplements

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$478 – $887
estimated annualized
Shopify rank
#2,022,922
global
Outranks
50.4%
of Shopify stores
Overall rank
#8,927,434
all platforms
Outranks
39.8%
of all tracked stores
Related domains
2
Variants
5
Vendors
2
Collections
1
Avg. price (USD)
$40.88
Min price (USD)
$33.69
Max price (USD)
$51.12
Location
Richmond, Americas
Subregion
Northern America
Theme
dawn (Shopify)
default · vUnknown
Trustpilot
3.3 / 5
1 reviews
Newest product
launched 308 days ago
Storefront languages
EN
site language
Est. store created
Oct 10, 2025
SL last updated
Sep 25, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (4)

Blockify Fraud Filter, Blocker

Blockify Fraud Filter, Blocker

fraud · geolocation

Gaining 972 stores / 30d

Kaching Subscriptions App

Kaching Subscriptions App

subscriptions · discounts

Gaining 2,801 stores / 30d

Blockify ‑ Fraud IP Blocker

Blockify ‑ Fraud IP Blocker

fraud · ip blocker

Gaining 825 stores / 30d

Synctrack PayPal Tracking Sync

Synctrack PayPal Tracking Sync

order tracking · fraud

Gaining 950 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayShop Pay

Quick answers about Auvra Supplements

Figures are estimates from public data — never exact sales or revenue.

Is Auvra Supplements a dropshipping store?
Probably. auvrasupplements.com is a strong dropshipping match on WHAT Shipping?. We found Synctrack installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Auvra Supplements get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Auvra Supplements sell?
An estimated $436 – $2K in sales a month ($478 – $887 a year). It is a range estimated from public data, not reported revenue.
What does Auvra Supplements sell?
auvrasupplements.com lists about 8 products in Health › Nutrition › Vitamins & Supplements. Its likely best sellers are Auvra - Vitaminas Capilares Premium, Auvra - Advanced Collagen Blend (14-IN-1) and Auvra Milk Thistle Liver Detox & Colon Cleanse.
What apps does Auvra Supplements use?
WHAT Shipping? found 4 apps on auvrasupplements.com, including Blockify Fraud Filter, Blocker, Kaching Subscriptions App, Blockify ‑ Fraud IP Blocker and Synctrack PayPal Tracking Sync.
How old is Auvra Supplements?
auvrasupplements.com was created around Oct 10, 2025, about 11 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0