Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

B
Visit store
Open research tabsFree

Free account Β· 2 tabs Β· storefront + best-sellers

byitkpop.com

Byit β€” Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated <1K monthly traffic, 1,745 products in the crawled catalogue.

Shop the hottest K-POP merch!🎁 Get official goods, albums, photocards, and light sticksβ€”fast shipping & 100% authentic!πŸš€

Store catalogue last scanned 21 hours ago

Counts and rankings are estimates β€” not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range β€” a free account shows the point estimate

Est. sales range
$2K – $3K

Estimated monthly

Est. yearly sales
$18K – $34K

Estimated annualized

Products detected
1,745

~1,745 products on this store the last time we crawled it β€” not a live inventory count

Store age
1 yr 6 mo

Store Leads estimate

Platform confidence90%Store originSGPages / visit3.8First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 30, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match β€” not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.byitkpop.com.

Localised storefronts

The same catalogue served on a country or language domain β€” a merchant running these is already selling in more than one market.

www.byitkpop.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals β€” estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads β€” estimates, not a complete audit.

Classification

Categories

Arts & Entertainment β€Ί Music & Audio β€Ί Pop Music

Tags

Dropshipper

Features

FAQ PageTracking PageInternational ShippingShopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageSignature RequiredHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

Fedex
Est. yearly sales
$18K – $34K
estimated annualized
Shopify rank
#1,167,279
global
Outranks
71.4%
of Shopify stores
Overall rank
#5,021,707
all platforms
Outranks
66.1%
of all tracked stores
Monthly app spend
$65
est.
Related domains
1
Variants
4,416
Collections
88
Avg. price (USD)
$26.28
Min price (USD)
$1.30
Max price (USD)
$408.00
Location
Asia
Subregion
South-Eastern Asia
Theme
dawn (Shopify)
default Β· vUnknown
Avg. product weight
561 g
estimated β€” shipping cost proxy
New product images
149
last 30d Β· 858 in 90d
Storefront languages
EN
site language
Est. store created
Mar 7, 2025
SL last updated
Sep 23, 2026

Customer service pages

How this store handles tracking, returns and sizing β€” worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (34)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking Β· shipping

Gaining 4,633 stores / 30d

Affiliatly Affiliate Marketing

Affiliatly Affiliate Marketing

affiliate programs Β· loyalty and rewards

Gaining 14 stores / 30d

UpPromote Affiliate Marketing

UpPromote Affiliate Marketing

affiliate programs Β· loyalty and rewards

Gaining 602 stores / 30d

Airwallex Fraud Protection

Airwallex Fraud Protection

fraud

Gaining 31 stores / 30d

B&S ‑ Announcement Bar

B&S ‑ Announcement Bar

banners Β· notifications - other

Losing 25 stores / 30d

Preorder, Back In Stock ‑ STOQ

Preorder, Back In Stock ‑ STOQ

pre-orders Β· stock alerts

Gaining 1,193 stores / 30d

SEOWILL ‑ 404 Link Redirect

SEOWILL ‑ 404 Link Redirect

seo

XCloud Search & Product Filter

XCloud Search & Product Filter

search and filters Β· navigation and menus

Gaining 34 stores / 30d

+26 more apps on file

Technologies detected

Estimated technographics β€” not a complete audit.

AffiliatlyApple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerKlaviyoPayPal Express CheckoutSearchaniseShogunShop PaySwymTikTok PixelTrustedSiteTwitter PixelVimeoYouTube Player

Quick answers about Byit

Figures are estimates from public data β€” never exact sales or revenue.

Is Byit a dropshipping store?
Possibly. byitkpop.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Byit get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Byit sell?
An estimated $2K – $3K in sales a month ($18K – $34K a year). It is a range estimated from public data, not reported revenue.
What does Byit sell?
byitkpop.com lists about 1,745 products in Arts & Entertainment β€Ί Music & Audio β€Ί Pop Music. Its likely best sellers are Bts Official Light Stick Ver.4, ILLIT Official Light Stick and Stray Kids Official Light Stick ver.2.
What apps does Byit use?
WHAT Shipping? found 34 apps on byitkpop.com, including 17TRACK Order Tracking, Affiliatly Affiliate Marketing, UpPromote Affiliate Marketing, Airwallex Fraud Protection and B&S ‑ Announcement Bar.
How old is Byit?
byitkpop.com was created around Mar 7, 2025, about 1 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0