Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

C
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

casavelia.com

Casa Velia — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated <1K monthly traffic, 267 products in the crawled catalogue.

Discover Casa Velia, your boutique dedicated to the art of living at home. Decor, everyday objects, and unique creations for a warm, elegant, and inspiring home.

Store catalogue last scanned 16 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$350 – $650

Estimated monthly

Est. yearly sales
$4K – $8K

Estimated annualized

Products detected
267

~267 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 4 mo

Store Leads estimate

Platform confidence90%Store originFRPages / visit4.4First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 30, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

DSers

Dropship sourcing / fulfilment

+5

Trustoo

AliExpress review importer

+5

Hextom

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 2 other stores. Their best-ranked storefront is www.casavelia.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.casavelia.com

Unlock store depth for Casa Velia

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden › Home & Interior Decor

Tags

Dropshipper

Features

FAQ PageGift MessagingShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Accepts Gift CardsContact Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$4K – $8K
estimated annualized
Shopify rank
#2,339,398
global
Outranks
42.7%
of Shopify stores
Overall rank
#10,389,358
all platforms
Outranks
30.0%
of all tracked stores
Monthly app spend
$22
est.
Related domains
2
Variants
2,168
Vendors
1
Collections
10
Avg. price (USD)
$42.44
Min price (USD)
$10.00
Max price (USD)
$558.00
Location
Marseille, Europe
Subregion
Western Europe
Theme
dawn (Shopify)
default · vUnknown
Avg. product weight
2.4 kg
estimated — shipping cost proxy
New product images
57
last 30d · 299 in 90d
Newest product
launched 9 days ago
Storefront languages
EN
site language
Est. store created
May 16, 2025
SL last updated
Sep 23, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (8)

Colissimo Official

Colissimo Official

shipping · delivery and pickup

Losing 33 stores / 30d

DSers: Dropship+AliExpress+AI

DSers: Dropship+AliExpress+AI

dropshipping

Losing 2,300 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

CWILL(Trustoo) Product Reviews

CWILL(Trustoo) Product Reviews

email marketing · product reviews

Losing 276 stores / 30d

Smart SEO AI & Image Optimizer

Smart SEO AI & Image Optimizer

seo · image editor

Gaining 852 stores / 30d

Qikify Slide Cart Drawer

Qikify Slide Cart Drawer

cart customization · upsell and cross-sell

Gaining 6 stores / 30d

Trustoo Ali Reviews Importer

Trustoo Ali Reviews Importer

product reviews

Losing 154 stores / 30d

Hextom: Upsell Sales Boost

Hextom: Upsell Sales Boost

countdown timer · upsell and cross-sell

Losing 349 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseKlarnaTikTok Pixel

Quick answers about Casa Velia

Figures are estimates from public data — never exact sales or revenue.

Is Casa Velia a dropshipping store?
Probably. casavelia.com is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews, DSers, Trustoo and Hextom installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Casa Velia get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Casa Velia sell?
An estimated $350 – $650 in sales a month ($4K – $8K a year). It is a range estimated from public data, not reported revenue.
What does Casa Velia sell?
casavelia.com lists about 267 products in Home & Garden › Home & Interior Decor. Its likely best sellers are Coiffeuse de chambre avec grand miroir, Robot Lave-Vitres Automatique and Aspirateur Laveur 2-en-1 150W.
What apps does Casa Velia use?
WHAT Shipping? found 8 apps on casavelia.com, including Colissimo Official, DSers: Dropship+AliExpress+AI, Klarna On‑Site Messaging, CWILL(Trustoo) Product Reviews and Smart SEO AI & Image Optimizer.
How old is Casa Velia?
casavelia.com was created around May 16, 2025, about 1 yr 4 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0