Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

C
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

creedpop.com

CreedPOP — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated 1K–5K monthly traffic, 50 products in the crawled catalogue.

Store catalogue last scanned 19 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
50

~50 products on this store the last time we crawled it — not a live inventory count

Store age
10 mo

Store Leads estimate

Platform confidence90%Store originGBFirst crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

Trustoo

AliExpress review importer

+5

Parcel Panel / ParcelWILL

Package tracking

+3

Hextom

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.creedpop.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.creedpop.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,005,428
global
Outranks
50.9%
of Shopify stores
Overall rank
#8,861,762
all platforms
Outranks
40.3%
of all tracked stores
Related domains
1
Variants
2
Vendors
2
Collections
20
Avg. price (USD)
$84.00
Min price (USD)
$79.00
Max price (USD)
$89.00
Location
Europe
Subregion
Northern Europe
Theme
trade (Shopify)
default · vUnknown
Newest product
launched 125 days ago
Storefront languages
EN
site language
Est. store created
Nov 21, 2025
SL last updated
Sep 24, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (9)

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Gaining 1,000 stores / 30d

Seel Worry‑Free Purchase

Seel Worry‑Free Purchase

returns and exchanges · orders - other

Gaining 1,065 stores / 30d

CWILL(Trustoo) Product Reviews

CWILL(Trustoo) Product Reviews

email marketing · product reviews

Losing 276 stores / 30d

SalesPop: Order & Sales Popup

SalesPop: Order & Sales Popup

pop-ups · social proof

Losing 126 stores / 30d

Trustoo Ali Reviews Importer

Trustoo Ali Reviews Importer

product reviews

Losing 154 stores / 30d

Hextom: Upsell Sales Boost

Hextom: Upsell Sales Boost

countdown timer · upsell and cross-sell

Losing 349 stores / 30d

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayKlarnaNamecheap EmailParcelPanelShop Pay

Quick answers about CreedPOP

Figures are estimates from public data — never exact sales or revenue.

Is CreedPOP a dropshipping store?
Probably. creedpop.com is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews, Trustoo, Parcel Panel / ParcelWILL and Hextom installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does CreedPOP get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does CreedPOP sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does CreedPOP sell?
creedpop.com lists about 50 products in Apparel. Its likely best sellers are Women Vest Suspenders Fashion Sexy Vest, Women Vest Suspenders Bow Bandage Sexy Vest and Women Vest Suspenders.
What apps does CreedPOP use?
WHAT Shipping? found 9 apps on creedpop.com, including Shopify Inbox, Klarna On‑Site Messaging, CWILL Order Tracking, Seel Worry‑Free Purchase and CWILL(Trustoo) Product Reviews.
How old is CreedPOP?
creedpop.com was created around Nov 21, 2025, about 10 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0