Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

D
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

downy-friends.com

Downy Friends — Traffic, Sales & Best SellersADAEAFAGAI+213

Possible dropshipping match, with estimated <1K monthly traffic, 839 products in the crawled catalogue.

Downy Friends is a shop that sells plush toys from various franchises, such as Pokemon, One Piece, Naruto, Dragon Ball, Harry Potter, Nintendo, Disney, and more.

Store catalogue last scanned 1 day ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$571 – $1K

Estimated monthly

Est. yearly sales
$7K – $13K

Estimated annualized

Products detected
839

~839 products on this store the last time we crawled it — not a live inventory count

Store age
3 yr

Store Leads estimate

Platform confidence90%Store originFRPages / visit4.0First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 2, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.downy-friends.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.downyfriends.frwww.downy-friends.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.downyfriends.fr

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Arts & Entertainment › Comics & Animation › Anime & MangaArts & Entertainment › Comics & Animation

Features

Tracking PageShopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

Fedex
Est. yearly sales
$7K – $13K
estimated annualized
Shopify rank
#783,047
global
Outranks
80.8%
of Shopify stores
Overall rank
#3,055,950
all platforms
Outranks
79.4%
of all tracked stores
Related domains
1
Variants
888
Vendors
1
Collections
74
Avg. price (USD)
$28.82
Min price (USD)
$11.61
Max price (USD)
$62.74
Location
Rungis, Europe
Subregion
Western Europe
Theme
shopiweb premium (Unknown)
vUnknown
Newest product
launched 225 days ago
Storefront languages
EN
site language
Est. store created
Sep 15, 2023
SL last updated
Sep 21, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (13)

FBP | Fast Bundle & Upsell App

FBP | Fast Bundle & Upsell App

product bundles · upsell and cross-sell

Gaining 216 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

Loox ‑ Product Reviews App

Loox ‑ Product Reviews App

product reviews · social proof

Gaining 1,778 stores / 30d

Okendo: Reviews & Loyalty

Okendo: Reviews & Loyalty

product reviews · loyalty and rewards

Gaining 265 stores / 30d

Omnisend Email Marketing & SMS

Omnisend Email Marketing & SMS

email marketing · sms marketing

Gaining 616 stores / 30d

Product Reviews

Product Reviews

product reviews

Gaining 108 stores / 30d

+5 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle AnalyticsGoogle Analytics 4Google Tag ManagerGoogle WorkspaceKlarnaOkendoOmnisendPayPal Express CheckoutPinterest PixelShop PaySnap PixelTikTok PixelZakeke

Quick answers about Downy Friends

Figures are estimates from public data — never exact sales or revenue.

Is Downy Friends a dropshipping store?
Possibly. downy-friends.com is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Downy Friends get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Downy Friends sell?
An estimated $571 – $1K in sales a month ($7K – $13K a year). It is a range estimated from public data, not reported revenue.
What does Downy Friends sell?
downy-friends.com lists about 839 products in Arts & Entertainment › Comics & Animation › Anime & Manga and Arts & Entertainment › Comics & Animation. Its likely best sellers are Bellibolt, Shiny Hisuian Zorua and Shiny Zeraora.
What apps does Downy Friends use?
WHAT Shipping? found 13 apps on downy-friends.com, including FBP | Fast Bundle & Upsell App, Shopify Inbox, Judge.me Product Reviews App, Klarna On‑Site Messaging and Loox ‑ Product Reviews App.
How old is Downy Friends?
downy-friends.com was created around Sep 15, 2023, about 3 yr ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0