Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

E
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

embrolygift.com

Embrolygift — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated 1K–5K monthly traffic, 2,868 products in the crawled catalogue.

Shop unique, custom gifts for any occasion! Enjoy easy ordering & fast turnaround. Create personalized gifts today!

Store catalogue last scanned 3 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$40K – $75K

Estimated monthly

Est. yearly sales
$482K – $895K

Estimated annualized

Products detected
2,868

~2,868 products on this store the last time we crawled it — not a live inventory count

Store age
2 yr 6 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.embrolygift.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.embrolygift.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

f9c1d5-43.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Gifts & Special Events

Features

Shopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageTracking PageFAQ PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$482K – $895K
estimated annualized
Social followers
7
estimated
Shopify rank
#149,323
global
Outranks
96.3%
of Shopify stores
Overall rank
#426,338
all platforms
Outranks
97.1%
of all tracked stores
Related domains
1
Variants
11,738
Vendors
1
Collections
213
Avg. price (USD)
$73.85
Min price (USD)
$1.00
Max price (USD)
$999.99
Location
Boulder, Americas
Subregion
Northern America
Theme
ecomus (Unknown)
v1.7.0
Trustpilot
2.6 / 5
42 reviews
Avg. product weight
5.9 kg
estimated — shipping cost proxy
New product images
1,236
last 30d · 4,453 in 90d
Newest product
Sep 20, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Mar 22, 2024
SL last updated
Sep 17, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (13)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Dr Stacked Discounts on Cart

Dr Stacked Discounts on Cart

discounts · cart customization

Beast Currency Converter

Beast Currency Converter

currency and translation

HelpLab FAQ Page, Product FAQs

HelpLab FAQ Page, Product FAQs

faq · page builder

King Product Options, Variants

King Product Options, Variants

product variants · custom products - other

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Loox ‑ Product Reviews App

Loox ‑ Product Reviews App

product reviews · social proof

Parkour: Facebook Pixel & Feed

Parkour: Facebook Pixel & Feed

ads · analytics

+5 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayKlaviyoPayPal CheckoutPayPal Express CheckoutPinterest PixelShop PayTikTok PixelVimeoYouTube Player

Quick answers about Embrolygift

Figures are estimates from public data — never exact sales or revenue.

Is Embrolygift a dropshipping store?
Possibly. embrolygift.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Embrolygift get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Embrolygift sell?
An estimated $40K – $75K in sales a month ($482K – $895K a year). It is a range estimated from public data, not reported revenue.
What does Embrolygift sell?
embrolygift.com lists about 2,868 products in Gifts & Special Events. Its likely best sellers are Wear Your Heart on Your Sleeve – Personalized Mama Sweatshirt with Kids’ Names | for Mom and Grandma Gift | Mother's Day Gift, Custom Patchwork Fabric Embroidered Polka Dot Sweatshirt Team and School Name Applique Varsity Letters | Game Day Wear and Custom Embroidered Glitter Vinyl Team Polka Dot Sweatshirt - Game Day Best Gear | Gifts for Sports Mom | Game Day Wear.
What apps does Embrolygift use?
WHAT Shipping? found 13 apps on embrolygift.com, including 17TRACK Order Tracking, Dr Stacked Discounts on Cart, Beast Currency Converter, HelpLab FAQ Page, Product FAQs and King Product Options, Variants.
How old is Embrolygift?
embrolygift.com was created around Mar 22, 2024, about 2 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0