Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

E
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

evoevs.com

EVOEVS– Evoevs — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated <1K monthly traffic, 285 products in the crawled catalogue.

Evoevs offers a range of driving-enhancing Kia EV5 accessories/Volvo EX30 accessories and ZEEKR X accessories that combine style and environmental awareness.

Store catalogue last scanned 15 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$1K – $2K

Estimated monthly

Est. yearly sales
$15K – $28K

Estimated annualized

Products detected
285

~285 products on this store the last time we crawled it — not a live inventory count

Store age
2 yr 2 mo

Store Leads estimate

Platform confidence90%Store originCNPages / visit3.8First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 2, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.evoevs.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.evoevs.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

7f446d-d8.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Autos & Vehicles › Parts & Services

Features

Shopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageTracking PageSignature RequiredHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

UPSFedexUSPS
Est. yearly sales
$15K – $28K
estimated annualized
Shopify rank
#624,836
global
Outranks
84.7%
of Shopify stores
Overall rank
#2,256,409
all platforms
Outranks
84.8%
of all tracked stores
Monthly app spend
$15
est.
Related domains
1
Variants
890
Vendors
1
Collections
26
Avg. price (USD)
$67.61
Min price (USD)
$3.99
Max price (USD)
$269.99
Location
Qingdao, Asia
Subregion
Eastern Asia
Theme
impulse (Archetype Themes)
modern · v7.5.0 · $500 theme
Newest product
launched 382 days ago
Storefront languages
EN
site language
Est. store created
Aug 2, 2024
SL last updated
Sep 23, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (7)

Nova: Multi Currency Converter

Nova: Multi Currency Converter

currency and translation

Losing 115 stores / 30d

Avada AI SEO Image Optimizer

Avada AI SEO Image Optimizer

seo · image editor

Losing 264 stores / 30d

BixGrow Affiliate Marketing

BixGrow Affiliate Marketing

affiliate programs · loyalty and rewards

Gaining 3,735 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Gaining 1,000 stores / 30d

Product Reviews

Product Reviews

product reviews

Gaining 108 stores / 30d

Waivers E‑Signatures‑SignPanda

Waivers E‑Signatures‑SignPanda

storefronts - other · digital goods and services - other

Gaining 1 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

ArriveCloudflareCloudflare CDNJudge.meParcelPanelPayPal Express CheckoutVimeoYouTube Player

Quick answers about EVOEVS– Evoevs

Figures are estimates from public data — never exact sales or revenue.

Is EVOEVS– Evoevs a dropshipping store?
Possibly. evoevs.com is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does EVOEVS– Evoevs get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does EVOEVS– Evoevs sell?
An estimated $1K – $2K in sales a month ($15K – $28K a year). It is a range estimated from public data, not reported revenue.
What does EVOEVS– Evoevs sell?
evoevs.com lists about 285 products in Autos & Vehicles › Parts & Services. Its likely best sellers are Proximity Card Key Holder for Volvo EX30, Key Fob Cover for Kia EV5 and Door Sill Protectors for Kia EV5.
What apps does EVOEVS– Evoevs use?
WHAT Shipping? found 7 apps on evoevs.com, including Nova: Multi Currency Converter, Avada AI SEO Image Optimizer, BixGrow Affiliate Marketing, Judge.me Product Reviews App and CWILL Order Tracking.
How old is EVOEVS– Evoevs?
evoevs.com was created around Aug 2, 2024, about 2 yr 2 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0