Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

F
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

fashionexpress.store

Fashion Express — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with estimated <1K monthly traffic, 162 products in the crawled catalogue, under six months old by Store Leads estimate.

Shop the latest fashion trends, stylish outfits, accessories, skincare, and wellness products at Fashion Express. Premium quality at affordable prices with fast, convenient online shopping and new arrivals every week.

Store catalogue last scanned 19 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$1K – $2K

Estimated monthly

Est. yearly sales
$15K – $28K

Estimated annualized

Products detected
162

~162 products on this store the last time we crawled it — not a live inventory count

Store age
4 mo

Store Leads estimate

Platform confidence90%Store originGBPages / visit3.8First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 1, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.fashionexpress.store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.fashionexpress.store

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

tcykcq-kc.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Face & Body Care

Features

Shopify New Customer AccountsCryptocurrency MessagingShopify Online Store 2.0New Shopify Checkout (2022)Contact PageFree ReturnsInternational ShippingTracking or ReturnsReturns PageTracking PageFAQ PageBrand Advocate Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$15K – $28K
estimated annualized
Shopify rank
#662,496
global
Outranks
83.8%
of Shopify stores
Overall rank
#2,447,575
all platforms
Outranks
83.5%
of all tracked stores
Related domains
1
Variants
2,876
Vendors
2
Collections
10
Avg. price (USD)
$22.51
Min price (USD)
$5.78
Max price (USD)
$231.54
Location
London, Europe
Subregion
Northern Europe
Theme
refresh (Shopify)
default · vUnknown
Avg. product weight
339 g
estimated — shipping cost proxy
New product images
114
last 30d · 183 in 90d
Newest product
launched 14 days ago
Storefront languages
EN
site language
Est. store created
May 15, 2026
SL last updated
Sep 21, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (6)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

GOAFFPRO ‑ Affiliate Marketing

GOAFFPRO ‑ Affiliate Marketing

affiliate programs

Gaining 496 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

Shopify Forms

Shopify Forms

email marketing · pop-ups

Gaining 7,190 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

AfterpayApple PayArriveCloudflareCloudflare CDNGoAffProGoogle Ads PixelGoogle AdsenseGoogle PayJudge.meKlarnaPinterest PixelShop PayTikTok Pixel

Quick answers about Fashion Express

Figures are estimates from public data — never exact sales or revenue.

Is Fashion Express a dropshipping store?
Possibly. fashionexpress.store is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Fashion Express get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Fashion Express sell?
An estimated $1K – $2K in sales a month ($15K – $28K a year). It is a range estimated from public data, not reported revenue.
What does Fashion Express sell?
fashionexpress.store lists about 162 products in Beauty & Fitness › Face & Body Care. Its likely best sellers are 1L Motivational Sports Water Bottle with Time Marker, Men's Corduroy Lace-Up Drawstring Shorts and Long-sleeve Chunky-knit Sweater.
What apps does Fashion Express use?
WHAT Shipping? found 6 apps on fashionexpress.store, including 17TRACK Order Tracking, GOAFFPRO ‑ Affiliate Marketing, Shopify Inbox, Judge.me Product Reviews App and Klarna On‑Site Messaging.
How old is Fashion Express?
fashionexpress.store was created around May 15, 2026, about 4 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0