Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

G
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

glamu.shop

Glamu — Traffic, Sales & Best SellersADAEAFAGAI+212

Possible dropshipping match, with estimated <1K monthly traffic, 513 products in the crawled catalogue.

Glamu offers high-quality Beauty & Wellness products to help You look and feel Your best. Shop skincare, self-care, and more for a radiant lifestyle.

Store catalogue last scanned 1 day ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
513

~513 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 4 mo

Store Leads estimate

Platform confidence90%Store originLTPages / visit4.4First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 2, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Vitals

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 4 other stores.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

glamu.euglamu.eeglamu.ltglamu.lv

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

87z1n7-ya.myshopify.comwww.glamu.lt

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Face & Body Care › Skin & Nail Care

Features

Shopify New Customer AccountsContact PageInternational ShippingShopify Online Store 2.0New Shopify Checkout (2022)Tracking or ReturnsTracking PageFAQ PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

UPS
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,968,969
global
Outranks
51.8%
of Shopify stores
Overall rank
#8,728,067
all platforms
Outranks
41.2%
of all tracked stores
Monthly app spend
$30
est.
Related domains
5
Variants
491
Vendors
12
Collections
299
Avg. price (USD)
$24.30
Min price (USD)
$4.00
Max price (USD)
$93.00
Location
Vilnius, Europe
Subregion
Northern Europe
Theme
hyper (FoxEcom)
hyper · vUnknown · $400 theme
Avg. product weight
339 g
estimated — shipping cost proxy
Newest product
launched 151 days ago
Storefront languages
EN
site language
Est. store created
May 23, 2025
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (9)

Discounty: Bulk Discount Sales

Discounty: Bulk Discount Sales

discounts · pricing optimization

Gaining 161 stores / 30d

Geolocation

Geolocation

internationalization - other

Losing 433 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Gaining 6,161 stores / 30d

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Gaining 1,000 stores / 30d

Geolocation & Markets—Selecty

Geolocation & Markets—Selecty

geolocation · currency and translation

Gaining 99 stores / 30d

Tidio: AI Chatbot & Live Chat

Tidio: AI Chatbot & Live Chat

chat · helpdesk

Losing 63 stores / 30d

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayGoogle Tag ManagerJudge.meKlarnaKlaviyoParcelPanelPayPal Express CheckoutShop PayTidioVimeoYouTube Player

Quick answers about Glamu

Figures are estimates from public data — never exact sales or revenue.

Is Glamu a dropshipping store?
Possibly. glamu.shop is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL and Vitals installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Glamu get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Glamu sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Glamu sell?
glamu.shop lists about 513 products in Beauty & Fitness › Face & Body Care › Skin & Nail Care. Its likely best sellers are Farmona Filler & Lifting Massage Face Cream 280ml, Nanogen Root Boost Thickening Spray 100ml and Elan LashPLEX 2.0 Eyelash Care Concentrate 10ml.
What apps does Glamu use?
WHAT Shipping? found 9 apps on glamu.shop, including Discounty: Bulk Discount Sales, Geolocation, Judge.me Product Reviews App, Klarna On‑Site Messaging and Klaviyo: Email Marketing & SMS.
How old is Glamu?
glamu.shop was created around May 23, 2025, about 1 yr 4 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0