Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

G
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

godsthrift.com

Gods Thrift Athens — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated <1K monthly traffic, 839 products in the crawled catalogue.

Ανακαλύψτε επιλεγμένα vintage & streetwear στο Gods Thrift, το premium thrift store της Αθήνας στο Νέο Ηράκλειο. Χειροποίητα ρετρό ρούχα, φούτερ, τζάκετ και μοναδικά κομμάτια. Ψωνίστε online ή στο κατάστημα για ποιοτική vintage μόδα, βιώσιμο στυλ και αποκλειστικά drops.

Store catalogue last scanned 9 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$1K – $2K

Estimated monthly

Est. yearly sales
$14K – $26K

Estimated annualized

Products detected
839

~839 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 11 mo

Store Leads estimate

Platform confidence90%Store originGRPages / visit3.8First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.godsthrift.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.godsthrift.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.godsthriftathens.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Features

FAQ PageShopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Contact PageTracking or ReturnsTracking PageBrands PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

Fedex
Est. yearly sales
$14K – $26K
estimated annualized
Shopify rank
#660,492
global
Outranks
83.8%
of Shopify stores
Overall rank
#2,438,670
all platforms
Outranks
83.6%
of all tracked stores
Monthly app spend
$7
est.
Related domains
1
Variants
766
Vendors
1
Collections
66
Avg. price (USD)
$53.92
Min price (USD)
$5.69
Max price (USD)
$267.13
Location
Heraklion, Europe
Subregion
Southern Europe
Theme
minimog - os 2.0 (Unknown)
vUnknown
Avg. product weight
305 g
estimated — shipping cost proxy
New product images
325
last 30d · 384 in 90d
Storefront languages
EN
site language
Merchant type
Retailer
lists the brands they sell
Est. store created
Oct 4, 2024
SL last updated
Sep 21, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (20)

AG Product Reviews App & UGC

AG Product Reviews App & UGC

product reviews

Gaining 655 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Bundler » Product Bundles App

Bundler » Product Bundles App

product bundles · upsell and cross-sell

Losing 64 stores / 30d

Essent Cart Drawer Cart Upsell

Essent Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 494 stores / 30d

Google & YouTube

Google & YouTube

marketplaces · ads

Gaining 3,185 stores / 30d

Reputon Google Reviews

Reputon Google Reviews

product reviews · social proof

Losing 901 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

+12 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoKwikGoogle Ads PixelGoogle PayGoogle WorkspaceKlarnaMicrosoft ClarityPayPal Express CheckoutSendinblueShop PayVimeoYouTube Player

Quick answers about Gods Thrift Athens

Figures are estimates from public data — never exact sales or revenue.

Is Gods Thrift Athens a dropshipping store?
Possibly. godsthrift.com is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Gods Thrift Athens get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Gods Thrift Athens sell?
An estimated $1K – $2K in sales a month ($14K – $26K a year). It is a range estimated from public data, not reported revenue.
What does Gods Thrift Athens sell?
godsthrift.com lists about 839 products in Apparel. Its likely best sellers are Adidas Originals 3 Stripes Shorts | Navy Blue | Size M, Vintage Polo Ralph Lauren Jacket Black (S) and 00s Adidas Bucket Hat Black (OS).
What apps does Gods Thrift Athens use?
WHAT Shipping? found 20 apps on godsthrift.com, including AG Product Reviews App & UGC, BUCKS Currency Converter PRO++, Bundler » Product Bundles App, Essent Cart Drawer Cart Upsell and Google & YouTube.
How old is Gods Thrift Athens?
godsthrift.com was created around Oct 4, 2024, about 1 yr 11 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0