Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

H
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

herglw.com

Herglw — Traffic, Sales & Best SellersADAEAFAGAI+213

Possible dropshipping match, with estimated <1K monthly traffic, 145 products in the crawled catalogue.

Store catalogue last scanned 10 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$6K – $11K

Estimated monthly

Est. yearly sales
$73K – $136K

Estimated annualized

Products detected
145

~145 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 10 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

se.herglw.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Face & Body Care › Skin & Nail CareHealth › Health Conditions › Skin Conditions

Features

Shopify New Customer AccountsShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Free ReturnsContact Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$73K – $136K
estimated annualized
Shopify rank
#430,106
global
Outranks
89.5%
of Shopify stores
Overall rank
#1,399,536
all platforms
Outranks
90.6%
of all tracked stores
Monthly app spend
$30
est.
Related domains
1
Variants
722
Vendors
1
Collections
2
Avg. price (USD)
$33.47
Min price (USD)
$8.99
Max price (USD)
$179.99
Location
Casper, Americas
Subregion
Northern America
Theme
trademark (Maestrooo)
gold · v1.6.0 · $180 theme
Avg. product weight
256 g
estimated — shipping cost proxy
New product images
47
last 30d · 114 in 90d
Newest product
launched 21 days ago
Storefront languages
EN
site language
Est. store created
Nov 22, 2024
SL last updated
Sep 22, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (15)

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 5,653 stores / 30d

Atlas: AI Store Builder

Atlas: AI Store Builder

page builder · storefronts - other

Gaining 1,029 stores / 30d

MG Instagram Feed TikTok Feed

MG Instagram Feed TikTok Feed

social proof · selling online - other

Losing 14 stores / 30d

Kiwi Size Chart & Recommender

Kiwi Size Chart & Recommender

product comparison · product variants

Gaining 400 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Gaining 7,780 stores / 30d

Monster Cart Upsell+ Free Gift

Monster Cart Upsell+ Free Gift

cart customization · gifts - other

Gaining 91 stores / 30d

Omega ‑ Multi Snapchat Pixels

Omega ‑ Multi Snapchat Pixels

ads · analytics

Gaining 1 stores / 30d

PageFly ✦ AI Page Builder

PageFly ✦ AI Page Builder

page builder · upsell and cross-sell

Gaining 2,832 stores / 30d

+7 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayKlaviyoPayPal Express CheckoutPinterest PixelReChargeRecurpayShop PaySnap PixelTikTok PixelZoho Mail

Quick answers about Herglw

Figures are estimates from public data — never exact sales or revenue.

Is Herglw a dropshipping store?
Possibly. herglw.com is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Herglw get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Herglw sell?
An estimated $6K – $11K in sales a month ($73K – $136K a year). It is a range estimated from public data, not reported revenue.
What does Herglw sell?
herglw.com lists about 145 products in Beauty & Fitness › Face & Body Care › Skin & Nail Care and Health › Health Conditions › Skin Conditions. Its likely best sellers are FLASH SALE: Free brush Peptide Bounce Foundation, HerGlw Brightening Pads and Stick & Stay Peel-off Lip Stain.
What apps does Herglw use?
WHAT Shipping? found 15 apps on herglw.com, including BUCKS Currency Converter PRO++, Atlas: AI Store Builder, MG Instagram Feed TikTok Feed, Kiwi Size Chart & Recommender and Klaviyo: Email Marketing & SMS.
How old is Herglw?
herglw.com was created around Nov 22, 2024, about 1 yr 10 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0