Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

H
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

homvesss.com

Homvesss — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 3 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 2 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
3

~3 products on this store the last time we crawled it — not a live inventory count

Store age
11 days

Store Leads estimate

Platform confidence90%Store originHKFirst crawledSep 27, 2026Last crawled listingSep 28, 2026Last crawledSep 27, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.homvesss.com.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

yrmssv-tx.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Features

Contact PageTracking or ReturnsReturns PageTracking PageFAQ Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,508,404
global
Outranks
63.1%
of Shopify stores
Overall rank
#6,864,681
all platforms
Outranks
53.7%
of all tracked stores
Related domains
1
Collections
1
Location
Asia
Subregion
Eastern Asia
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
Storefront languages
EN
site language
Est. store created
Sep 18, 2026
SL last updated
Sep 19, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (1)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

CloudflareCloudflare CDN

Quick answers about Homvesss

Figures are estimates from public data — never exact sales or revenue.

Is Homvesss a dropshipping store?
Possibly. homvesss.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Homvesss sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Homvesss sell?
homvesss.com lists about 3 products. Its likely best sellers are 100K+ SOLD Bruise Repair & Skin-Strengthening Cream, Advanced Anti-Aging Probiotic Facial Night Cream with 17-Peptide Complex for Wrinkles on Face and Neck Nourishing Hydrating Skin Repair Firming Smooth and Lutein Eye Spray.
What apps does Homvesss use?
WHAT Shipping? found 1 app on homvesss.com, including 17TRACK Order Tracking.
How old is Homvesss?
homvesss.com was created around Sep 18, 2026, about 11 days ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0