Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

L
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

luckanime.com

LUCKANIME LIMITED — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated <1K monthly traffic, 1,706 products in the crawled catalogue.

LuckAnime is your ultimate destination for premium anime merch. Discover high-quality phone cases featuring One Piece, Naruto, Jujutsu Kaisen, Dragon Ball, and exclusive K-POP collections for BTS and G-Dragon fans. Enjoy Free Worldwide Shipping and our Buy 2 Get 1 Free deal. Shop now and showcase your anime passion!

Store catalogue last scanned 15 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$12K – $22K

Estimated monthly

Est. yearly sales
$143K – $265K

Estimated annualized

Products detected
1,706

~1,706 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 11 mo

Store Leads estimate

Platform confidence90%Store originGBPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.luckanime.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.luckanime.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

luckanime.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Arts & Entertainment › Comics & Animation › Anime & Manga

Features

Shopify Online Store 2.0International ShippingFree ReturnsNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageTracking PageFAQ Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

USPS
Est. yearly sales
$143K – $265K
estimated annualized
Shopify rank
#312,393
global
Outranks
92.4%
of Shopify stores
Overall rank
#960,788
all platforms
Outranks
93.5%
of all tracked stores
Related domains
1
Variants
8,615
Vendors
8
Collections
32
Avg. price (USD)
$28.31
Min price (USD)
$12.89
Max price (USD)
$799.00
Location
Coventry, Europe
Subregion
Northern Europe
Theme
dawn (Shopify)
default · vUnknown
Avg. product weight
107 g
estimated — shipping cost proxy
New product images
117
last 30d · 257 in 90d
Newest product
Sep 20, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Oct 11, 2024
SL last updated
Sep 22, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (3)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Shopify Inbox

Shopify Inbox

chat

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayKlarnaShop PayZoho Mail

Quick answers about LUCKANIME LIMITED

Figures are estimates from public data — never exact sales or revenue.

Is LUCKANIME LIMITED a dropshipping store?
Possibly. luckanime.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does LUCKANIME LIMITED get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does LUCKANIME LIMITED sell?
An estimated $12K – $22K in sales a month ($143K – $265K a year). It is a range estimated from public data, not reported revenue.
What does LUCKANIME LIMITED sell?
luckanime.com lists about 1,706 products in Arts & Entertainment › Comics & Animation › Anime & Manga. Its likely best sellers are Snoopy Phone Case, 2026 BTS Phone Case and LOL-Jinx-Fashion Anime-Case-for-Hot.
What apps does LUCKANIME LIMITED use?
WHAT Shipping? found 3 apps on luckanime.com, including 17TRACK Order Tracking, Shopify Inbox and Klarna On‑Site Messaging.
How old is LUCKANIME LIMITED?
luckanime.com was created around Oct 11, 2024, about 1 yr 11 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0