Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

L
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

luxurrycover.com

LUXURRYCOVER — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated 25K–50K monthly traffic, 1,149 products in the crawled catalogue.

Store catalogue last scanned 3 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
25K–50K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
1,149

~1,149 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 6 mo

Store Leads estimate

Platform confidence90%Store originFRPages / visit0.0First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 1, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

DSers

Dropship sourcing / fulfilment

+5

Parcel Panel / ParcelWILL

Package tracking

+3

Vitals

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.luxurrycover.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.luxurrycover.com

Unlock store depth for LUXURRYCOVER

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Consumer Electronics

Tags

Print on DemandDropshipper

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageInternational ShippingTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,957,107
global
Outranks
52.1%
of Shopify stores
Overall rank
#8,686,470
all platforms
Outranks
41.4%
of all tracked stores
Monthly app spend
$30
est.
Related domains
1
Variants
51,822
Vendors
7
Collections
41
Avg. price (USD)
$28.69
Min price (USD)
$4.13
Max price (USD)
$249.99
Location
La Clusaz, Europe
Subregion
Western Europe
Theme
dawn (Shopify)
default · vUnknown
Avg. product weight
63 g
estimated — shipping cost proxy
New product images
1,783
last 30d · 2,314 in 90d
Storefront languages
EN
site language
Est. store created
Mar 7, 2025
SL last updated
Sep 24, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (14)

Addingwell ‑ GTM & DataLayer

Addingwell ‑ GTM & DataLayer

analytics

Gaining 91 stores / 30d

Nova: Multi Currency Converter

Nova: Multi Currency Converter

currency and translation

Losing 115 stores / 30d

T Lab ‑ AI Language Translate

T Lab ‑ AI Language Translate

currency and translation

Gaining 70 stores / 30d

Customily Product Personalizer

Customily Product Personalizer

print on demand (pod) · custom file upload

Gaining 570 stores / 30d

DSers: Dropship+AliExpress+AI

DSers: Dropship+AliExpress+AI

dropshipping

Losing 2,300 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Gaining 1,000 stores / 30d

+6 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNCustomilyFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle Tag ManagerKlarnaParcelPanelPayPal Express CheckoutShop PayZoho Mail

Quick answers about LUXURRYCOVER

Figures are estimates from public data — never exact sales or revenue.

Is LUXURRYCOVER a dropshipping store?
Probably. luxurrycover.com is a strong dropshipping match on WHAT Shipping?. We found DSers, Parcel Panel / ParcelWILL and Vitals installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does LUXURRYCOVER get?
An estimated 25K–50K visits a month. This is an estimate from public data, not the store's own analytics.
How much does LUXURRYCOVER sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does LUXURRYCOVER sell?
luxurrycover.com lists about 1,149 products in Consumer Electronics. Its likely best sellers are Premium GYD Vintage Case For iPhone 12-18 Pro & Pro Max, Luxury Fashion Case For iPhone 16 / 15 / 14 and DR Luxury Leather Phone Case For iPhone 12-18 Pro & Pro Max.
What apps does LUXURRYCOVER use?
WHAT Shipping? found 14 apps on luxurrycover.com, including Addingwell ‑ GTM & DataLayer, Nova: Multi Currency Converter, T Lab ‑ AI Language Translate, Customily Product Personalizer and DSers: Dropship+AliExpress+AI.
How old is LUXURRYCOVER?
luxurrycover.com was created around Mar 7, 2025, about 1 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0