Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

M
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

maisoncelie.com

MAISON CELIE™ STORE — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated <1K monthly traffic, 4,297 products in the crawled catalogue.

Store catalogue last scanned 17 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$5K – $8K

Estimated monthly

Est. yearly sales
$55K – $102K

Estimated annualized

Products detected
4,297

~4,297 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 5 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 1, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ryviu

AliExpress review importer

+5

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.maisoncelie.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.maisoncelie.com

Unlock store depth for MAISON CELIE™ STORE

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Google active ads
0
checked Aug 8, 2026
Meta active ads
0
checked Aug 8, 2026
TikTok active ads
0
checked Aug 8, 2026

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Women's Clothing

Features

Shopify Online Store 2.0Product Page Video TagInternational ShippingNew Shopify Checkout (2022)Free ReturnsAccepts Gift CardsContact PageTracking or ReturnsReturns PageTracking PageSizing Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$55K – $102K
estimated annualized
Shopify rank
#913,548
global
Outranks
77.6%
of Shopify stores
Overall rank
#3,843,534
all platforms
Outranks
74.1%
of all tracked stores
Monthly app spend
$15
est.
Related domains
1
Variants
19,602
Vendors
11
Collections
47
Avg. price (USD)
$155.56
Min price (USD)
$0.10
Max price (USD)
$1,186.92
Location
Boulder, Americas
Subregion
Northern America
Theme
refresh (Shopify)
default · vUnknown
Avg. product weight
922 kg
estimated — shipping cost proxy
New product images
6
last 30d · 1,656 in 90d
Newest product
launched 47 days ago
Storefront languages
EN
site language
Est. store created
May 2, 2025
SL last updated
Sep 22, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (9)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

EG Auto Add to Cart Free Gift

EG Auto Add to Cart Free Gift

cart customization · discounts

Gaining 280 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Gaining 6,161 stores / 30d

Klaviyo: Product Reviews

Klaviyo: Product Reviews

product reviews

Gaining 126 stores / 30d

Omnise ✧ AI Page Builder

Omnise ✧ AI Page Builder

page builder · storefronts - other

Losing 112 stores / 30d

Reelfy Shoppable Videos & UGC

Reelfy Shoppable Videos & UGC

video and livestream · social proof

Gaining 102 stores / 30d

Ryviu: Loyalty & Reviews App

Ryviu: Loyalty & Reviews App

product reviews · loyalty and rewards

Losing 3 stores / 30d

One Click Upsell ‑ Zipify OCU

One Click Upsell ‑ Zipify OCU

upsell and cross-sell · cart customization

Gaining 361 stores / 30d

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerKlaviyoPayPal Express CheckoutPinterest PixelShop PayTwitter PixelVimeo

Quick answers about MAISON CELIE™ STORE

Figures are estimates from public data — never exact sales or revenue.

Is MAISON CELIE™ STORE a dropshipping store?
Probably. maisoncelie.com is a strong dropshipping match on WHAT Shipping?. We found Ryviu and 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does MAISON CELIE™ STORE get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does MAISON CELIE™ STORE sell?
An estimated $5K – $8K in sales a month ($55K – $102K a year). It is a range estimated from public data, not reported revenue.
What does MAISON CELIE™ STORE sell?
maisoncelie.com lists about 4,297 products in Apparel › Women's Clothing. Its likely best sellers are Celie crystal faux-pearl earrings, Lillie Spaghetti Floral Ruffle Mini Dress - White and Juliete Floral Cutout Backless Top - White.
What apps does MAISON CELIE™ STORE use?
WHAT Shipping? found 9 apps on maisoncelie.com, including 17TRACK Order Tracking, EG Auto Add to Cart Free Gift, Klaviyo: Email Marketing & SMS, Klaviyo: Product Reviews and Omnise ✧ AI Page Builder.
How old is MAISON CELIE™ STORE?
maisoncelie.com was created around May 2, 2025, about 1 yr 5 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0