Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

M
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

mheboost.com

MHE — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated <1K monthly traffic, 19 products in the crawled catalogue.

Store catalogue last scanned 2 months ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$1K – $2K

Estimated monthly

Est. yearly sales
$12K – $23K

Estimated annualized

Products detected
19

~19 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 5 mo

Store Leads estimate

Platform confidence90%Store originBEPages / visit3.8First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledJul 5, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.mheboost.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.mheboost.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

saludiaria.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Health › Nutrition › Vitamins & Supplements

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Free ReturnsContact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$12K – $23K
estimated annualized
Shopify rank
#1,255,173
global
Outranks
69.3%
of Shopify stores
Overall rank
#5,569,136
all platforms
Outranks
62.5%
of all tracked stores
Related domains
1
Variants
35
Vendors
1
Collections
5
Avg. price (USD)
$65.71
Min price (USD)
$26.25
Max price (USD)
$146.19
Location
Brussels, Europe
Subregion
Western Europe
Theme
crave (Shopify)
default · vUnknown
Newest product
launched 40 days ago
Storefront languages
EN
site language
Est. store created
Apr 4, 2025
SL last updated
Sep 24, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (13)

Aftersell Post Purchase Upsell

Aftersell Post Purchase Upsell

upsell and cross-sell · checkout - other

Gaining 473 stores / 30d

Appstle Loyalty Program Reward

Appstle Loyalty Program Reward

loyalty and rewards

Gaining 837 stores / 30d

FAQs, Helpdesk, Chat, WhatsApp

FAQs, Helpdesk, Chat, WhatsApp

store design · customer service

Gaining 122 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Chatty AI Chatbot & Live Chat

Chatty AI Chatbot & Live Chat

chat · faq

Gaining 61 stores / 30d

Kiwi Size Chart & Recommender

Kiwi Size Chart & Recommender

product comparison · product variants

Gaining 304 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

α OnePixel: Facebook Pixel API

α OnePixel: Facebook Pixel API

ads · analytics

Losing 85 stores / 30d

+5 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle PayKlarnaShop PayTikTok Pixel

Quick answers about MHE

Figures are estimates from public data — never exact sales or revenue.

Is MHE a dropshipping store?
Possibly. mheboost.com is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does MHE get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does MHE sell?
An estimated $1K – $2K in sales a month ($12K – $23K a year). It is a range estimated from public data, not reported revenue.
What does MHE sell?
mheboost.com lists about 19 products in Health › Nutrition › Vitamins & Supplements. Its likely best sellers are Aerosol Natural, Apple Cider Vinegar Gummies and Collagen Keratin Gummies.
What apps does MHE use?
WHAT Shipping? found 13 apps on mheboost.com, including Aftersell Post Purchase Upsell, Appstle Loyalty Program Reward, FAQs, Helpdesk, Chat, WhatsApp, BUCKS Currency Converter PRO++ and Chatty AI Chatbot & Live Chat.
How old is MHE?
mheboost.com was created around Apr 4, 2025, about 1 yr 5 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0