Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

B
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

mwansi.com

Butcha shop — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Strong dropshipping match, with estimated 10K–25K monthly traffic, 483 products in the crawled catalogue, under six months old by Store Leads estimate.

We exclusively sell high-quality products made in Italy. We offer a range of products, including beauty, wellness, home, and decoration items, as well as electronics and high-tech products that enhance people's lives. We also sell winter products.

Store catalogue last scanned 3 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
10K–25K

Estimated range — a free account shows the point estimate

Est. sales range
$40 – $74

Estimated monthly

Est. yearly sales
$476 – $885

Estimated annualized

Products detected
483

~483 products on this store the last time we crawled it — not a live inventory count

Store age
6 days

Store Leads estimate

Platform confidence90%Store originITFirst crawledSep 27, 2026Last crawled listingSep 30, 2026Last crawledSep 28, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

Trustoo

AliExpress review importer

+5

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.mwansi.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.mwansi.comwww.butchashop.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

butcha-shop.myshopify.comwww.butchashop.com

Unlock store depth for Butcha shop

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Features

Tracking PageShopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsFAQ PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$476 – $885
estimated annualized
Social followers
63
estimated
Shopify rank
#1,394,678
global
Outranks
65.8%
of Shopify stores
Overall rank
#6,479,059
all platforms
Outranks
56.3%
of all tracked stores
Related domains
1
Vendors
1
Collections
30
Location
Europe
Subregion
Southern Europe
Theme
dawn (Shopify)
default · vUnknown
Storefront languages
IT
site language
Est. store created
Sep 25, 2026
SL last updated
Sep 23, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (16)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Replo Landing Page Builder

Replo Landing Page Builder

page builder

Gaining 927 stores / 30d

BixGrow Affiliate Marketing

BixGrow Affiliate Marketing

affiliate programs · loyalty and rewards

Gaining 3,735 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Essential Upsell & Cross Sell

Essential Upsell & Cross Sell

upsell and cross-sell · cart customization

Gaining 9 stores / 30d

BOGOS: Free Gift Bundle Upsell

BOGOS: Free Gift Bundle Upsell

product bundles · discounts

Gaining 207 stores / 30d

GSC Countdown Timer Bar

GSC Countdown Timer Bar

countdown timer · banners

Gaining 504 stores / 30d

Tapita AI SEO Optimizer, Speed

Tapita AI SEO Optimizer, Speed

seo · image editor

Losing 2 stores / 30d

+8 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayPayPal CheckoutPayPal Express CheckoutShop PayTikTok Pixel

Quick answers about Butcha shop

Figures are estimates from public data — never exact sales or revenue.

Is Butcha shop a dropshipping store?
Probably. mwansi.com is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews, Trustoo and 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Butcha shop get?
An estimated 10K–25K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Butcha shop sell?
An estimated $40 – $74 in sales a month ($476 – $885 a year). It is a range estimated from public data, not reported revenue.
What does Butcha shop sell?
mwansi.com lists about 483 products. Its likely best sellers are 2025 New 15.6" Windows 11 Laptop Computer Intel Celeron N4000 Fingerprint Unlock Computer 16GB DDR4 1/2TB SSD Notebook Laptops, S25 Ultra 2026, Smartphone, 6.8" HD, 8GB RAM + 256GB Storage and 2026 New Core i9 10980HK Portable Laptop Computer 16GB DDR4 1TB 2TB SSD 14.1" Notebook Windows 11 Pro 4K Office Study Gaming PC.
What apps does Butcha shop use?
WHAT Shipping? found 16 apps on mwansi.com, including 17TRACK Order Tracking, Replo Landing Page Builder, BixGrow Affiliate Marketing, BUCKS Currency Converter PRO++ and Essential Upsell & Cross Sell.
How old is Butcha shop?
mwansi.com was created around Sep 25, 2026, about 6 days ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0