Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

M
Visit store
Open research tabsFree

Free account · 3 tabs · storefront + best-sellers + ads

myparismonaco.com

MyParisMonaco — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated 10K–25K monthly traffic, 1,043 products in the crawled catalogue.

MyParisMonaco, your chic fashion destination for women, combining Parisian elegance with Monegasque sophistication. Delivery in Europe and Internationally, luxury Parisian fashion, elegant women's clothing, premium brand, chic accessories, timeless Parisian style, French fashion boutique.

Store catalogue last scanned 14 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
10K–25K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
1,043

~1,043 products on this store the last time we crawled it — not a live inventory count

Store age
6 mo

Store Leads estimate

Platform confidence90%Store originFRFirst crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 1, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Modalyst

Dropship sourcing / fulfilment

+5

Trendsi

Dropship sourcing / fulfilment

+5

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.myparismonaco.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.myparismonaco.com

Unlock store depth for MyParisMonaco

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown
  • · Meta advertiser profile

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Google active ads
0
checked Aug 29, 2026
Meta active ads
0
checked Aug 29, 2026
TikTok active ads
0
checked Aug 29, 2026

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Tags

Print on DemandDropshipper

Features

FAQ PageShopify Online Store 2.0Free ReturnsNew Shopify Checkout (2022)Contact PageSignature RequiredTracking or ReturnsTracking PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,543,213
global
Outranks
37.7%
of Shopify stores
Overall rank
#11,532,903
all platforms
Outranks
22.3%
of all tracked stores
Monthly app spend
$59
est.
Related domains
1
Variants
11,260
Vendors
1
Collections
15
Avg. price (USD)
$61.34
Min price (USD)
$0.43
Max price (USD)
$1,517.99
Location
Lombers, Europe
Subregion
Western Europe
Theme
dawn (Shopify)
default · vUnknown
Avg. product weight
399 g
estimated — shipping cost proxy
New product images
1,900
last 30d · 3,598 in 90d
Storefront languages
EN
site language
Est. store created
Mar 13, 2026
SL last updated
Sep 23, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (26)

MX AI: Background Music Player

MX AI: Background Music Player

animation and effects · promotions - other

Gaining 6 stores / 30d

Essent Estimated Delivery Date

Essent Estimated Delivery Date

delivery and pickup · shipping rates

Gaining 314 stores / 30d

Pandectes GDPR Compliance

Pandectes GDPR Compliance

cookie consent · accessibility

Gaining 597 stores / 30d

Globo Mega Menu, Navigation

Globo Mega Menu, Navigation

navigation and menus · search and navigation - other

Losing 9 stores / 30d

Google & YouTube

Google & YouTube

marketplaces · ads

Gaining 3,185 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

XO Insert Code

XO Insert Code

product content · storefronts - other

Gaining 43 stores / 30d

Joy Wishlist app

Joy Wishlist app

wishlists · email marketing

Gaining 65 stores / 30d

+18 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle Tag ManagerJudge.meKlarnaKlaviyoLineParcelPanelPayPal Express CheckoutPinterest PixelShop PayVimeoYouTube Player

Quick answers about MyParisMonaco

Figures are estimates from public data — never exact sales or revenue.

Is MyParisMonaco a dropshipping store?
Probably. myparismonaco.com is a strong dropshipping match on WHAT Shipping?. We found Modalyst, Trendsi and Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does MyParisMonaco get?
An estimated 10K–25K visits a month. This is an estimate from public data, not the store's own analytics.
How much does MyParisMonaco sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does MyParisMonaco sell?
myparismonaco.com lists about 1,043 products in Apparel. Its likely best sellers are Robe débardeur à franges et col en V, Barboteuse rayée zippée à manches courtes and Cape en maille unie à lien noué devant.
What apps does MyParisMonaco use?
WHAT Shipping? found 26 apps on myparismonaco.com, including MX AI: Background Music Player, Essent Estimated Delivery Date, Pandectes GDPR Compliance, Globo Mega Menu, Navigation and Google & YouTube.
How old is MyParisMonaco?
myparismonaco.com was created around Mar 13, 2026, about 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0