Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

N
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

normadesignusa.com

Norma Design — Traffic, Sales & Best SellersAFAGAIALAM+184

Shopify Plus

Strong dropshipping match, with estimated <1K monthly traffic, 22 products in the crawled catalogue.

Make everyday life more comfortable, more sustainable and less painful.

Store catalogue last scanned 5 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$3K – $5K

Estimated monthly

Est. yearly sales
$30K – $57K

Estimated annualized

Products detected
22

~22 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr

Store Leads estimate

Platform confidence90%Store originPLUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 24, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

Trustoo

AliExpress review importer

+5

Parcel Panel / ParcelWILL

Package tracking

+3

Vitals

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

norma-design.dknormadesign.atnormadesign.dethenormadesign.comnormadesignaustralia.comnormadesign.benorma-design.eunormadesign.esnormadesign.co.uknormadesignireland.comnorma-design.itnormadesign.nl+3 more

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.thenormadesign.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Features

FAQ PageShopify Online Store 2.0Cryptocurrency MessagingProduct Page Video TagNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageTracking PageWholesale/Retailers PageBrand Advocate Page

Markets & shipping

Ships to / sells in

AFAGAIALAMAOATAUAWAZBBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCKCMCNCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFRGAGBGDGEGFGHGLGMGNGPGQGRGSGTGWGYHKHNHTHUIEILIQITJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLKLRLSLTLULYMAMFMGMLMMMNMOMQMRMSMTMVMWMYMZNANCNENFNGNINLNONPNRNUPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSYEZMZW

Shipping carriers

FedexUSPSCanada PostCorreos
Est. yearly sales
$30K – $57K
estimated annualized
Shopify rank
#530,751
global
Outranks
87.0%
of Shopify stores
Overall rank
#1,819,507
all platforms
Outranks
87.7%
of all tracked stores
Monthly app spend
$134
est.
Related domains
2
Variants
75
Vendors
2
Collections
6
Avg. price (USD)
$49.79
Min price (USD)
$4.95
Max price (USD)
$129.94
Location
Cedarhurst, Americas
Subregion
Northern America
Plan
Shopify Plus
Theme
impact (Maestrooo)
home · vUnknown · $400 theme
Avg. product weight
386 g
estimated — shipping cost proxy
New product images
7
last 30d · 7 in 90d
Newest product
launched 36 days ago
Storefront languages
EN
site language
Merchant type
Brand
lists retailers who stock them
Est. store created
Sep 12, 2025
SL last updated
Sep 18, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (27)

Aftersell Post Purchase Upsell

Aftersell Post Purchase Upsell

upsell and cross-sell · checkout - other

Gaining 473 stores / 30d

Also Bought CBB

Also Bought CBB

cart customization · upsell and bundles - other

Gaining 51 stores / 30d

Attrac Popup, Announcement Bar

Attrac Popup, Announcement Bar

banners · pop-ups

Gaining 247 stores / 30d

AppLovin

AppLovin

ads

Gaining 2,743 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Kaching Bundles App & Upsells

Kaching Bundles App & Upsells

product bundles · upsell and cross-sell

Gaining 4,147 stores / 30d

Kaching CartDrawer Cart Upsell

Kaching CartDrawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 494 stores / 30d

Shopify Checkout Blocks

Shopify Checkout Blocks

checkout - other · discounts

Gaining 1,316 stores / 30d

+19 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

AfterpayAppLovin AXON PixelApple PayArriveCloudflareCloudflare CDNCriteoFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerKlaviyoMicrosoft ClarityParcelPanelPayPal Express CheckoutShop PayTriple WhaleVimeoYouTube Playerwetracked.io

Quick answers about Norma Design

Figures are estimates from public data — never exact sales or revenue.

Is Norma Design a dropshipping store?
Probably. normadesignusa.com is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews, Trustoo, Parcel Panel / ParcelWILL and Vitals installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Norma Design get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Norma Design sell?
An estimated $3K – $5K in sales a month ($30K – $57K a year). It is a range estimated from public data, not reported revenue.
What does Norma Design sell?
normadesignusa.com lists about 22 products in Apparel. Its likely best sellers are Fascia Peanut Massage Ball, 2 Acupuncture Mats and Grounding Mat.
What apps does Norma Design use?
WHAT Shipping? found 27 apps on normadesignusa.com, including Aftersell Post Purchase Upsell, Also Bought CBB, Attrac Popup, Announcement Bar, AppLovin and BUCKS Currency Converter PRO++.
How old is Norma Design?
normadesignusa.com was created around Sep 12, 2025, about 1 yr ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0