Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

P
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

paintonnumbers.ca

Paint On Numbers — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated 5K–10K monthly traffic, 488 products in the crawled catalogue.

Canada's top paint by number store. 300+ kits for adults, kids & custom orders. Premium canvas, vivid paints, free shipping $75+ CAD. Satisfaction guaranteed.

Store catalogue last scanned 1 day ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
5K–10K

Estimated range — a free account shows the point estimate

Est. sales range
$72K – $134K

Estimated monthly

Est. yearly sales
$868K – $2M

Estimated annualized

Products detected
488

~488 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 6 mo

Store Leads estimate

Platform confidence90%Store originINCAPages / visit3.7First crawledJun 26, 2026Last crawled listingSep 28, 2026Last crawledSep 28, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 3 other stores. Their best-ranked storefront is www.paintonnumbers.ca.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.paintonnumbers.ca

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

uzg2ex-ic.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden › Home Improvement › House Painting & Finishing

Features

Shopify Online Store 2.0International ShippingCorporate Gift MessagingNew Shopify Checkout (2022)Accepts Gift CardsContact PageTracking or ReturnsReturns PageSignature RequiredTracking PageFAQ PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$868K – $2M
estimated annualized
Social followers
13
estimated
Shopify rank
#125,826
global
Outranks
96.9%
of Shopify stores
Overall rank
#354,420
all platforms
Outranks
97.6%
of all tracked stores
Monthly app spend
$30
est.
Related domains
3
Variants
4,367
Vendors
1
Collections
27
Avg. price (USD)
$49.68
Min price (USD)
$11.99
Max price (USD)
$200.00
Location
Cambridge, Americas
Subregion
Northern America
Theme
trade (Shopify)
default · vUnknown
Trustpilot
4.2 / 5
16 reviews
Avg. product weight
100 g
estimated — shipping cost proxy
New product images
6
last 30d · 19 in 90d
Newest product
Aug 8, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Mar 28, 2025
SL last updated
Sep 22, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (6)

AG Product Reviews App & UGC

AG Product Reviews App & UGC

product reviews

CWILL Popup Email Marketing

CWILL Popup Email Marketing

pop-ups · email marketing

File Upload & Image ‑ Uploadly

File Upload & Image ‑ Uploadly

custom file upload

Magic: Exchanges and Returns

Magic: Exchanges and Returns

inventory optimization · returns and exchanges

Swym Wishlist Plus

Swym Wishlist Plus

wishlists · selling in person - other

Track123 Order Tracking

Track123 Order Tracking

order tracking · shipping

Technologies detected

Estimated technographics — not a complete audit.

ArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayShop PayTrustpilotZoho Mail

Quick answers about Paint On Numbers

Figures are estimates from public data — never exact sales or revenue.

Is Paint On Numbers a dropshipping store?
Possibly. paintonnumbers.ca is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Paint On Numbers get?
An estimated 5K–10K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Paint On Numbers sell?
An estimated $72K – $134K in sales a month ($868K – $2M a year). It is a range estimated from public data, not reported revenue.
What does Paint On Numbers sell?
paintonnumbers.ca lists about 488 products in Home & Garden › Home Improvement › House Painting & Finishing. Its likely best sellers are Custom Paint By Numbers, Custom Diamond Painting Kit and Custom Pet Paint By Numbers.
What apps does Paint On Numbers use?
WHAT Shipping? found 6 apps on paintonnumbers.ca, including AG Product Reviews App & UGC, CWILL Popup Email Marketing, File Upload & Image ‑ Uploadly, Magic: Exchanges and Returns and Swym Wishlist Plus.
How old is Paint On Numbers?
paintonnumbers.ca was created around Mar 28, 2025, about 1 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0