Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

P
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

pindblock.com

PIND BLOCK® — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated 1K–5K monthly traffic, 263 products in the crawled catalogue.

Shop bold Punjabi streetwear, unique Punjabi t-shirts, and culture-inspired clothes at Pind Block. Express your roots with premium fits designed for modern Punjabis worldwide.

Store catalogue last scanned 20 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$25K – $47K

Estimated monthly

Est. yearly sales
$305K – $567K

Estimated annualized

Products detected
263

~263 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 6 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.pindblock.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.pindblock.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

pindblock.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Tags

DropshipperPrint on Demand

Features

FAQ PageShopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Contact PageTracking or ReturnsTracking PageBrand Advocate PageHas BlogSizing Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$305K – $567K
estimated annualized
Shopify rank
#637,097
global
Outranks
84.4%
of Shopify stores
Overall rank
#2,312,378
all platforms
Outranks
84.4%
of all tracked stores
Related domains
1
Variants
1,952
Vendors
1
Collections
21
Avg. price (USD)
$66.63
Min price (USD)
$10.00
Max price (USD)
$500.00
Location
Beverly Hills, Americas
Subregion
Northern America
Theme
prestige (Maestrooo)
Strass · vUnknown · $400 theme
Avg. product weight
336 g
estimated — shipping cost proxy
Newest product
launched 153 days ago
Storefront languages
EN
site language
Est. store created
Mar 21, 2025
SL last updated
Sep 24, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (10)

Affirm pay‑over‑time messaging

Affirm pay‑over‑time messaging

advertising - other

Gaining 138 stores / 30d

BixGrow Affiliate Marketing

BixGrow Affiliate Marketing

affiliate programs · loyalty and rewards

Gaining 3,735 stores / 30d

Bundler » Product Bundles App

Bundler » Product Bundles App

product bundles · upsell and cross-sell

Losing 64 stores / 30d

Instafeed ‑ Instagram Feed

Instafeed ‑ Instagram Feed

social proof · image gallery

Gaining 1,880 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Gaining 6,161 stores / 30d

Klaviyo: Product Reviews

Klaviyo: Product Reviews

product reviews

Gaining 126 stores / 30d

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Gaining 1,000 stores / 30d

+2 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

AffirmApple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerGoogle WorkspaceKlaviyoKlaviyo Customer HubParcelPanelPayPal Express CheckoutPinterest PixelPrintifyShop PayTikTok PixelVimeoYouTube Player

Quick answers about PIND BLOCK®

Figures are estimates from public data — never exact sales or revenue.

Is PIND BLOCK® a dropshipping store?
Possibly. pindblock.com is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does PIND BLOCK® get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does PIND BLOCK® sell?
An estimated $25K – $47K in sales a month ($305K – $567K a year). It is a range estimated from public data, not reported revenue.
What does PIND BLOCK® sell?
pindblock.com lists about 263 products in Apparel. Its likely best sellers are Virsa Phulkari Tee, Reign of Moosewala Tee and Virsa Phulkari Hoodie.
What apps does PIND BLOCK® use?
WHAT Shipping? found 10 apps on pindblock.com, including Affirm pay‑over‑time messaging, BixGrow Affiliate Marketing, Bundler » Product Bundles App, Instafeed ‑ Instagram Feed and Judge.me Product Reviews App.
How old is PIND BLOCK®?
pindblock.com was created around Mar 21, 2025, about 1 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0