Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

S
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

pl.sunthebrand.com

SunTheBrand — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Strong dropshipping match, with estimated <1K monthly traffic, 252 products in the crawled catalogue, under six months old by Store Leads estimate.

SuntheBrand marca de bikinis oceanwear beachwear y bañadores fundada en España Europa. Diseños exclusivos, trendy, modernos, sexy atrevidos, con calidad excelente, mucho color, y envíos gratis Free shipping. Nuestros diseños han sido seleccionados por estilistas para cubrir y favorecer la silueta.

Store catalogue last scanned 16 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$132 – $245

Estimated monthly

Est. yearly sales
$2K – $3K

Estimated annualized

Products detected
252

~252 products on this store the last time we crawled it — not a live inventory count

Store age
1 mo

Store Leads estimate

Platform confidence90%Store originESPages / visit4.0First crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 8 other stores. Their best-ranked storefront is it.sunthebrand.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

cs.sunthebrand.comgr.sunthebrand.comen.sunthebrand.comwww.sunthebrand.comhr.sunthebrand.compt.sunthebrand.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › SwimwearApparel › Women's Clothing

Features

Shopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Accepts Gift CardsContact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

Correos
Est. yearly sales
$2K – $3K
estimated annualized
Shopify rank
#3,062,862
global
Outranks
25.0%
of Shopify stores
Overall rank
#13,511,281
all platforms
Outranks
8.9%
of all tracked stores
Related domains
9
Vendors
18
Collections
17
Location
Madrid, Europe
Subregion
Southern Europe
Theme
retro (Slash Themes)
default · vUnknown · $280 theme
Storefront languages
PL
site language
Est. store created
Aug 7, 2026
SL last updated
Sep 18, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (9)

CAPI Facebook Pixel Meta API

CAPI Facebook Pixel Meta API

ads

Losing 35 stores / 30d

AliReviews: AliExpress Reviews

AliReviews: AliExpress Reviews

product reviews · social proof

Losing 339 stores / 30d

T Lab ‑ AI Language Translate

T Lab ‑ AI Language Translate

currency and translation

Gaining 70 stores / 30d

Instafeed ‑ Instagram Feed

Instafeed ‑ Instagram Feed

social proof · image gallery

Gaining 1,880 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Gaining 1,000 stores / 30d

Pop Convert ‑ Pop Ups, Banners

Pop Convert ‑ Pop Ups, Banners

pop-ups · email marketing

Losing 248 stores / 30d

Releasit COD Form & Upsells

Releasit COD Form & Upsells

pay later · upsell and cross-sell

Losing 832 stores / 30d

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerKlarnaParcelPanelPinterest PixelShop PayTikTok PixelTrustpilot

Quick answers about SunTheBrand

Figures are estimates from public data — never exact sales or revenue.

Is SunTheBrand a dropshipping store?
Probably. pl.sunthebrand.com is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews and Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does SunTheBrand get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does SunTheBrand sell?
An estimated $132 – $245 in sales a month ($2K – $3K a year). It is a range estimated from public data, not reported revenue.
What does SunTheBrand sell?
pl.sunthebrand.com lists about 252 products in Apparel › Swimwear and Apparel › Women's Clothing. Its likely best sellers are Milos, Koh Samui and Islamorada.
What apps does SunTheBrand use?
WHAT Shipping? found 9 apps on pl.sunthebrand.com, including CAPI Facebook Pixel Meta API, AliReviews: AliExpress Reviews, T Lab ‑ AI Language Translate, Instafeed ‑ Instagram Feed and Klarna On‑Site Messaging.
How old is SunTheBrand?
pl.sunthebrand.com was created around Aug 7, 2026, about 1 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0