Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

P
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

primetrend.net

PrimeTrend — Traffic, Sales & Best SellersADAEAFAGAI+202

New store (<6 months)

Strong dropshipping match, with estimated 1K–5K monthly traffic, 13 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 15 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$411 – $2K

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
13

~13 products on this store the last time we crawled it — not a live inventory count

Store age
3 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

CJdropshipping

Dropship sourcing / fulfilment

+5

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.primetrend.net.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.primetrend.net

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

x0sscd-s3.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Pets & Animals › Pet Food & SuppliesPets & Animals › Dogs

Tags

DropshipperPrint on Demand

Features

Tracking PageContact PageShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Tracking or ReturnsFAQ PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBSBTBWBYBZCACCCFCGCHCICKCMCNCRCWCXCYCZDEDJDKDMDODZEEEGERESETFIFJFOFRGAGBGDGEGGGHGIGLGMGNGPGQGRGTGWHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPFPGPHPKPLPMPNPTQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,606,336
global
Outranks
36.2%
of Shopify stores
Overall rank
#11,871,400
all platforms
Outranks
20.0%
of all tracked stores
Related domains
1
Vendors
1
Collections
6
Location
Coconut Creek, Americas
Subregion
Northern America
Theme
savor (Shopify)
savor · vUnknown
Storefront languages
EN
site language
Est. store created
Jun 19, 2026
SL last updated
Sep 26, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (3)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

CJdropshipping: Much Faster

CJdropshipping: Much Faster

dropshipping · print on demand (pod)

Gaining 91 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayPayPal Express Checkout

Quick answers about PrimeTrend

Figures are estimates from public data — never exact sales or revenue.

Is PrimeTrend a dropshipping store?
Probably. primetrend.net is a strong dropshipping match on WHAT Shipping?. We found CJdropshipping and 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does PrimeTrend get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does PrimeTrend sell?
An estimated $411 – $2K in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does PrimeTrend sell?
primetrend.net lists about 13 products in Pets & Animals › Pet Food & Supplies and Pets & Animals › Dogs. Its likely best sellers are Automatic Moving Bouncing Rolling Ball Smart Cat Toy Ball Self-Moving Kitten Toy For Indoor Cat Kitten, Pet Dog Rubber Ball Toys For Dogs Resistance To Bite Dog Chew Toys Puppy Pets Dogs Training Products and Dog Leash Retractable Leash And Dog Collar Spotlight Automatic Pet Dog Cat Traction Rope For Small Medium Dogs Pet Product.
What apps does PrimeTrend use?
WHAT Shipping? found 3 apps on primetrend.net, including 17TRACK Order Tracking, CJdropshipping: Much Faster and Shopify Inbox.
How old is PrimeTrend?
primetrend.net was created around Jun 19, 2026, about 3 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0