Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

P
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

pulsesport.es

PULSESPORT — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Strong dropshipping match, with estimated 1K–5K monthly traffic, 13 products in the crawled catalogue, under six months old by Store Leads estimate.

Bienvenido a nuestra tienda en línea, donde encontrarás una gran variedad de productos para el hogar, juguetes y artículos electrónicos de excelente calidad. Ofrecemos precios competitivos, compras seguras y envíos rápidos para que disfrutes de la mejor experiencia de compra.

Store catalogue last scanned 9 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$411 – $2K

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
13

~13 products on this store the last time we crawled it — not a live inventory count

Store age
2 mo

Store Leads estimate

Platform confidence90%Store originESFirst crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

EPROLO

Dropship sourcing / fulfilment

+5

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 4 other stores. Their best-ranked storefront is www.pulsesport.com.br.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.pulsesport.es

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Tags

Dropshipper

Features

Cryptocurrency MessagingNew Shopify Checkout (2022)Contact Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,622,111
global
Outranks
35.8%
of Shopify stores
Overall rank
#11,952,424
all platforms
Outranks
19.4%
of all tracked stores
Related domains
4
Vendors
1
Collections
2
Location
Manresa, Europe
Subregion
Southern Europe
Theme
crave (Shopify)
default · vUnknown
Storefront languages
EN
site language
Est. store created
Jul 24, 2026
SL last updated
Sep 26, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (2)

EPROLO‑Dropshipping & Branding

EPROLO‑Dropshipping & Branding

dropshipping

Gaining 360 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

AfterpayApple PayArriveCloudflareCloudflare CDNGoogle PayKlarnaShop Pay

Quick answers about PULSESPORT

Figures are estimates from public data — never exact sales or revenue.

Is PULSESPORT a dropshipping store?
Probably. pulsesport.es is a strong dropshipping match on WHAT Shipping?. We found EPROLO installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does PULSESPORT get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does PULSESPORT sell?
An estimated $411 – $2K in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does PULSESPORT sell?
pulsesport.es lists about 13 products. Its likely best sellers are 120 capsules of active vitamins B2、B6、B9、B12 for girls can be taken as vitamin E supplements, Googeer Testosterone Enhancing Drops, Food Supplements And Body Care Body Supplements and Creatine Gummies Sports Gummies.
What apps does PULSESPORT use?
WHAT Shipping? found 2 apps on pulsesport.es, including EPROLO‑Dropshipping & Branding and Klarna On‑Site Messaging.
How old is PULSESPORT?
pulsesport.es was created around Jul 24, 2026, about 2 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0