Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

G
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

qingnova.com

GINGNOVA — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Strong dropshipping match, with estimated 1K–5K monthly traffic, 10 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 17 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
10

~10 products on this store the last time we crawled it — not a live inventory count

Store age
4 mo

Store Leads estimate

Platform confidence90%Store originMAFirst crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.qingnova.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.qingnova.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

d0dn6y-cq.myshopify.com

Unlock store depth for GINGNOVA

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Tags

Dropshipper

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,490,246
global
Outranks
63.5%
of Shopify stores
Overall rank
#6,801,965
all platforms
Outranks
54.1%
of all tracked stores
Monthly app spend
$9
est.
Related domains
1
Variants
58
Vendors
3
Collections
1
Avg. price (USD)
$48.86
Min price (USD)
$19.98
Max price (USD)
$127.99
Location
Ait Ishaq, Africa
Subregion
Northern Africa
Theme
crave (Shopify)
default · vUnknown
Avg. product weight
280 g
estimated — shipping cost proxy
Newest product
launched 88 days ago
Storefront languages
EN
site language
Est. store created
May 29, 2026
SL last updated
Sep 21, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (9)

Ali Reviews: AI Product Review

Ali Reviews: AI Product Review

product reviews · email marketing

Losing 482 stores / 30d

AliReviews: AliExpress Reviews

AliReviews: AliExpress Reviews

product reviews · social proof

Losing 339 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Monster Cart Upsell+ Free Gift

Monster Cart Upsell+ Free Gift

cart customization · gifts - other

Losing 15 stores / 30d

MutualDropshipping

MutualDropshipping

dropshipping

Pumper Bundles Quantity Breaks

Pumper Bundles Quantity Breaks

discounts · product bundles

Gaining 192 stores / 30d

Recurpay Subscriptions App

Recurpay Subscriptions App

subscriptions · payment options - other

Gaining 36 stores / 30d

Optim : Auto & All in One SEO

Optim : Auto & All in One SEO

seo

Gaining 3 stores / 30d

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNPayPal Express CheckoutRecurpay

Quick answers about GINGNOVA

Figures are estimates from public data — never exact sales or revenue.

Is GINGNOVA a dropshipping store?
Probably. qingnova.com is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does GINGNOVA get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does GINGNOVA sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does GINGNOVA sell?
qingnova.com lists about 10 products. Its likely best sellers are لومي ليفت LumiLift, ThermaRelief Shoulder Massager and Electric Spray Airbag Massage Comb.
What apps does GINGNOVA use?
WHAT Shipping? found 9 apps on qingnova.com, including Ali Reviews: AI Product Review, AliReviews: AliExpress Reviews, BUCKS Currency Converter PRO++, Monster Cart Upsell+ Free Gift and MutualDropshipping.
How old is GINGNOVA?
qingnova.com was created around May 29, 2026, about 4 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0