Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

R
Visit store
Open research tabsFree

Free account · 3 tabs · storefront + best-sellers + ads

reboundfitness.com.au

Rebound Fitness — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated <1K monthly traffic, 591 products in the crawled catalogue.

Buy ATG Equipment from Australia's leading store. We stock affordable ATG equipment for Kneesovertoesguy Exercises and Kneesovertoes Training. These tools will help you to move better and relieve joint stress in the comfort of your own home. Make no mistake, the path to improving flexibility is not easy.

Store catalogue last scanned 22 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$11K – $20K

Estimated monthly

Est. yearly sales
$129K – $240K

Estimated annualized

Products detected
591

~591 products on this store the last time we crawled it — not a live inventory count

Store age
3 yr 11 mo

Store Leads estimate

Platform confidence90%Store originAUPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

DSers

Dropship sourcing / fulfilment

+5

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is reboundfitness.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

reboundfitness.store

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

reboundfitness.store

Unlock store depth for Rebound Fitness

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown
  • · Meta advertiser profile

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Google active ads
0
checked Sep 21, 2026
Meta active ads
0
checked Sep 21, 2026
TikTok active ads
0
checked Sep 21, 2026

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Fitness

Tags

Dropshipper

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageInternational ShippingTracking or ReturnsTracking PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

Australia Post
Est. yearly sales
$129K – $240K
estimated annualized
Shopify rank
#323,839
global
Outranks
92.1%
of Shopify stores
Overall rank
#1,001,279
all platforms
Outranks
93.3%
of all tracked stores
Related domains
2
Variants
868
Vendors
2
Collections
33
Avg. price (USD)
$76.06
Min price (USD)
$5.95
Max price (USD)
$743.99
Location
Brisbane, Oceania
Subregion
Australia and New Zealand
Theme
dawn (Shopify)
default · v15.2.0
Avg. product weight
12 kg
estimated — shipping cost proxy
Newest product
Mar 19, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Oct 14, 2022
SL last updated
Sep 21, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (9)

Commission Factory

Commission Factory

affiliate programs

DSers: Dropship+AliExpress+AI

DSers: Dropship+AliExpress+AI

dropshipping

Shopify Inbox

Shopify Inbox

chat

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

ReConvert post purchase upsell

ReConvert post purchase upsell

upsell and cross-sell · cart customization

ReelUp‑Shoppable Videos+Reels

ReelUp‑Shoppable Videos+Reels

video and livestream · social proof

Reputon Amazon Importer

Reputon Amazon Importer

store data importer · dropshipping

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayGoogle WorkspaceJudge.meKlaviyoPayPal Express CheckoutShop PayTikTok PixelYouTube Player

Quick answers about Rebound Fitness

Figures are estimates from public data — never exact sales or revenue.

Is Rebound Fitness a dropshipping store?
Probably. reboundfitness.com.au is a strong dropshipping match on WHAT Shipping?. We found DSers installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Rebound Fitness get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Rebound Fitness sell?
An estimated $11K – $20K in sales a month ($129K – $240K a year). It is a range estimated from public data, not reported revenue.
What does Rebound Fitness sell?
reboundfitness.com.au lists about 591 products in Beauty & Fitness › Fitness. Its likely best sellers are Thigh Master: Pink Adjustable Pelvic Floor Muscle Trainer with Smart Counter. Postpartum Recovery Tool, ATG Squat Wedge Block Sets and Pink 360 Degree Massage Roller For Lymphatic Drainage & Cellulite.
What apps does Rebound Fitness use?
WHAT Shipping? found 9 apps on reboundfitness.com.au, including Commission Factory, DSers: Dropship+AliExpress+AI, Shopify Inbox, Judge.me Product Reviews App and Klaviyo: Email Marketing & SMS.
How old is Rebound Fitness?
reboundfitness.com.au was created around Oct 14, 2022, about 3 yr 11 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0