Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

R
Visit store
Open research tabsFree

Free account · 4 tabs · storefront + best-sellers + ads

ridgecover.com

RIDGECOVER — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated <1K monthly traffic, 1,195 products in the crawled catalogue, active ads on Meta.

Store catalogue last scanned 12 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$6K – $11K

Estimated monthly

Est. yearly sales
$73K – $136K

Estimated annualized

Products detected
1,195

~1,195 products on this store the last time we crawled it — not a live inventory count

Store age
2 yr

Store Leads estimate

Advertising
Meta · Google

6 ad records on file

Platform confidence90%Store originFRPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledOct 1, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

DSers

Dropship sourcing / fulfilment

+5

17TRACK

Package tracking

+3

Track123

Package tracking

+3

Vitals

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.ridgecover.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.ridgecover.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

fd0021-c4.myshopify.com

See the 6 ads this store is running

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · 6 social ad creatives on file
  • · SEO & traffic source breakdown
  • · Meta advertiser profile

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Products recently matched to ads

Catalogue products whose landing URL matched an active ad in the last 30 days (signal — not confirmed spend).

Ads detected
6
live SERP
Verified ads
0
of ads detected
Last seen ad
Sep 21, 2026
estimated
Google active ads
0
checked Sep 21, 2026
Meta active ads
6
running ~33d
TikTok active ads
0
checked Sep 21, 2026

This shop has been running Meta ads for ~33 days. Browse shops with long-running ads.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Consumer Electronics › Mobile & Wireless › Mobile & Wireless AccessoriesConsumer ElectronicsConsumer Electronics › Mobile & Wireless › Mobile Phones

Tags

Print on DemandDropshipper

Features

Tracking PageShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageInternational Shipping

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$73K – $136K
estimated annualized
Shopify rank
#872,843
global
Outranks
78.6%
of Shopify stores
Overall rank
#3,618,886
all platforms
Outranks
75.6%
of all tracked stores
Monthly app spend
$50
est.
Related domains
1
Variants
52,812
Vendors
6
Collections
30
Avg. price (USD)
$28.69
Min price (USD)
$5.00
Max price (USD)
$450.00
Location
Paris, Europe
Subregion
Western Europe
Theme
dawn (Shopify)
default · vUnknown
Avg. product weight
62 g
estimated — shipping cost proxy
New product images
1,928
last 30d · 1,967 in 90d
Newest product
launched 14 days ago
Storefront languages
EN
site language
Est. store created
Sep 20, 2024
SL last updated
Sep 24, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (13)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Also Bought CBB

Also Bought CBB

cart customization · upsell and bundles - other

Gaining 51 stores / 30d

T Lab ‑ AI Language Translate

T Lab ‑ AI Language Translate

currency and translation

Gaining 70 stores / 30d

Customily Product Personalizer

Customily Product Personalizer

print on demand (pod) · custom file upload

Gaining 570 stores / 30d

DSers: Dropship+AliExpress+AI

DSers: Dropship+AliExpress+AI

dropshipping

Losing 2,300 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

PreOrder Globo | Back in Stock

PreOrder Globo | Back in Stock

pre-orders · stock alerts

Gaining 836 stores / 30d

+5 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNCustomilyFacebook PixelGoogle Ads PixelGoogle AdsenseKlarnaPayPal Express CheckoutPinterest PixelShop PayZoho Mail

Quick answers about RIDGECOVER

Figures are estimates from public data — never exact sales or revenue.

Is RIDGECOVER a dropshipping store?
Probably. ridgecover.com is a strong dropshipping match on WHAT Shipping?. We found DSers, 17TRACK, Track123 and Vitals installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does RIDGECOVER get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does RIDGECOVER sell?
An estimated $6K – $11K in sales a month ($73K – $136K a year). It is a range estimated from public data, not reported revenue.
What does RIDGECOVER sell?
ridgecover.com lists about 1,195 products in Consumer Electronics › Mobile & Wireless › Mobile & Wireless Accessories, Consumer Electronics and Consumer Electronics › Mobile & Wireless › Mobile Phones. Its likely best sellers are Premium MagSafe Protective Case for iPhone 12–18 Pro & Pro Max, Luxury Multi-Color Matte Glass Case For iPhone 13-18 Pro & Pro Max and Ultimate Protection For Your iPhone Camera Lens – Stylish, Durable, Perfect Fit.
What apps does RIDGECOVER use?
WHAT Shipping? found 13 apps on ridgecover.com, including 17TRACK Order Tracking, Also Bought CBB, T Lab ‑ AI Language Translate, Customily Product Personalizer and DSers: Dropship+AliExpress+AI.
Does RIDGECOVER run ads?
Yes. WHAT Shipping? has seen RIDGECOVER advertising on Meta and Google.
How old is RIDGECOVER?
ridgecover.com was created around Sep 20, 2024, about 2 yr ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0