Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

A
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

sh2i1u-yb.myshopify.com

AMOCART — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 121 products in the crawled catalogue, under six months old by Store Leads estimate.

Amocart Trading | Shop Premium Tools, Kitchen Appliances, Power Equipment, Solar Inverters & Commercial Food Makers. Enjoy Quality Products, Competitive Prices, Fast & Free Shipping, Secure Shopping, And Reliable Customer Support. Everything You Need For Your Home, Kitchen, And Business.

Store catalogue last scanned 18 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
121

~121 products on this store the last time we crawled it — not a live inventory count

Store age
1 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.amocart.co.ukwww.amocart.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden

Features

Shopify Online Store 2.0Free ReturnsNew Shopify Checkout (2022)Contact PageSignature RequiredTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

UPSFedex
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,785,592
global
Outranks
31.8%
of Shopify stores
Overall rank
#12,471,947
all platforms
Outranks
15.9%
of all tracked stores
Related domains
1
Vendors
5
Collections
11
Location
Albuquerque, Americas
Subregion
Northern America
Theme
dawn (Shopify)
default · vUnknown
Storefront languages
EN
site language
Est. store created
Aug 14, 2026
SL last updated
Sep 23, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (6)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Google & YouTube

Google & YouTube

marketplaces · ads

Gaining 3,185 stores / 30d

GPTLab: All in one AI SEO Suit

GPTLab: All in one AI SEO Suit

seo

Gaining 318 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

SEOLab: All in #1 SEO — AI SEO

SEOLab: All in #1 SEO — AI SEO

seo · image editor

Gaining 23,067 stores / 30d

Shopify Forms

Shopify Forms

email marketing · pop-ups

Gaining 7,190 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle AnalyticsGoogle Analytics 4Google PayGoogle Tag ManagerJudge.mePayPal Express CheckoutPinterest PixelShop PayTikTok Pixel

Quick answers about AMOCART

Figures are estimates from public data — never exact sales or revenue.

Is AMOCART a dropshipping store?
Possibly. sh2i1u-yb.myshopify.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does AMOCART sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does AMOCART sell?
sh2i1u-yb.myshopify.com lists about 121 products in Home & Garden. Its likely best sellers are Luminous Glasses Tech Sense Cool Sunglasses For Boys And Girls, Men's Multifunctional Hair Clipper Shaving Gadget and AI-powered Robotic Dog Tech-driven Programmable Machine Dog With Voice Interaction.
What apps does AMOCART use?
WHAT Shipping? found 6 apps on sh2i1u-yb.myshopify.com, including 17TRACK Order Tracking, Google & YouTube, GPTLab: All in one AI SEO Suit, Judge.me Product Reviews App and SEOLab: All in #1 SEO — AI SEO.
How old is AMOCART?
sh2i1u-yb.myshopify.com was created around Aug 14, 2026, about 1 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0