Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

S
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

sharedgifts.com.au

Shared Gifts — Traffic, Sales & Best SellersADAEAFAGAI+213

New store (<6 months)

Strong dropshipping match, with 188 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 13 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$25 – $46

Estimated monthly

Est. yearly sales
$295 – $547

Estimated annualized

Products detected
188

~188 products on this store the last time we crawled it — not a live inventory count

Store age
5 mo

Store Leads estimate

Platform confidence90%Store originAUFirst crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

LAI Product Reviews

AliExpress review importer

+5

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is sharedgifts.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

sharedgifts.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Gifts & Special Events

Tags

DropshipperPrint on Demand

Features

Tracking PageFAQ PageShopify Online Store 2.0New Shopify Checkout (2022)Contact PageSignature RequiredTracking or Returns

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSYEYTZAZMZW

Shipping carriers

UPSUSPSFedexAustralia Post
Est. yearly sales
$295 – $547
estimated annualized
Shopify rank
#2,538,368
global
Outranks
37.8%
of Shopify stores
Overall rank
#11,505,745
all platforms
Outranks
22.4%
of all tracked stores
Monthly app spend
$25
est.
Related domains
2
Variants
41
Vendors
5
Collections
23
Avg. price (USD)
$22.28
Min price (USD)
$2.87
Max price (USD)
$43.23
Location
Piara Waters, Oceania
Subregion
Australia and New Zealand
Theme
dawn (Shopify)
default · vUnknown
New product images
46
last 30d · 168 in 90d
Newest product
launched 7 days ago
Storefront languages
EN
site language
Est. store created
Apr 3, 2026
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (16)

Afterpay On‑Site Messaging

Afterpay On‑Site Messaging

payment experience

Gaining 203 stores / 30d

Blockify Checkout Customizer

Blockify Checkout Customizer

order limits · checkout - other

Gaining 250 stores / 30d

Google & YouTube

Google & YouTube

marketplaces · ads

Gaining 3,185 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Gaining 6,161 stores / 30d

LAI Product Reviews App

LAI Product Reviews App

product reviews · social proof

Gaining 11 stores / 30d

Monster Cart Upsell+ Free Gift

Monster Cart Upsell+ Free Gift

cart customization · gifts - other

Losing 15 stores / 30d

OC: Volume Discount Bundle App

OC: Volume Discount Bundle App

wholesale · discounts

Gaining 83 stores / 30d

PageFly ✦ AI Page Builder

PageFly ✦ AI Page Builder

page builder · upsell and cross-sell

Gaining 1,994 stores / 30d

+8 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

AfterpayApple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle PayKlaviyoPayPal Express CheckoutPinterest PixelReChargeRecurpayShineOnTikTok Pixel

Quick answers about Shared Gifts

Figures are estimates from public data — never exact sales or revenue.

Is Shared Gifts a dropshipping store?
Probably. sharedgifts.com.au is a strong dropshipping match on WHAT Shipping?. We found LAI Product Reviews and Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Shared Gifts sell?
An estimated $25 – $46 in sales a month ($295 – $547 a year). It is a range estimated from public data, not reported revenue.
What does Shared Gifts sell?
sharedgifts.com.au lists about 188 products in Gifts & Special Events. Its likely best sellers are Personalized "To My Son" Mug - Gift From Mum, The Day You Became My Dad - Moon Phase Rock Slate and F*ck This Shit Hidden Swear Message Funny Mug.
What apps does Shared Gifts use?
WHAT Shipping? found 16 apps on sharedgifts.com.au, including Afterpay On‑Site Messaging, Blockify Checkout Customizer, Google & YouTube, Klaviyo: Email Marketing & SMS and LAI Product Reviews App.
How old is Shared Gifts?
sharedgifts.com.au was created around Apr 3, 2026, about 5 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0