Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

S
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

sharedgifts.com

Shared Gifts — Traffic, Sales & Best SellersADAEAFAGAI+213

Strong dropshipping match, with estimated 5K–10K monthly traffic, 188 products in the crawled catalogue.

Store catalogue last scanned 18 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
5K–10K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
188

~188 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 11 mo

Store Leads estimate

Platform confidence90%Store originAUPages / visit0.0First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 28, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

LAI Product Reviews

AliExpress review importer

+5

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

sharedgifts.com.au

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.sharedgifts.com.au

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Gifts & Special Events

Tags

DropshipperPrint on Demand

Features

FAQ PageShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Contact PageSignature RequiredTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSYEYTZAZMZW

Shipping carriers

FedexUSPSUPSAustralia Post
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,448,196
global
Outranks
40.0%
of Shopify stores
Overall rank
#10,980,333
all platforms
Outranks
26.0%
of all tracked stores
Monthly app spend
$25
est.
Related domains
2
Variants
660
Vendors
2
Collections
23
Avg. price (USD)
$54.56
Min price (USD)
$2.99
Max price (USD)
$125.29
Location
Piara Waters, Oceania
Subregion
Australia and New Zealand
Theme
dawn (Shopify)
default · v11.0.0
Avg. product weight
28 g
estimated — shipping cost proxy
New product images
1
last 30d · 1 in 90d
Newest product
launched 47 days ago
Storefront languages
EN
site language
Est. store created
Oct 18, 2024
SL last updated
Sep 26, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (16)

Afterpay On‑Site Messaging

Afterpay On‑Site Messaging

payment experience

Gaining 203 stores / 30d

Blockify Checkout Customizer

Blockify Checkout Customizer

order limits · checkout - other

Gaining 250 stores / 30d

Google & YouTube

Google & YouTube

marketplaces · ads

Gaining 3,185 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

Gaining 6,161 stores / 30d

LAI Product Reviews App

LAI Product Reviews App

product reviews · social proof

Gaining 11 stores / 30d

Monster Cart Upsell+ Free Gift

Monster Cart Upsell+ Free Gift

cart customization · gifts - other

Losing 15 stores / 30d

OC: Volume Discount Bundle App

OC: Volume Discount Bundle App

wholesale · discounts

Gaining 83 stores / 30d

PageFly ✦ AI Page Builder

PageFly ✦ AI Page Builder

page builder · upsell and cross-sell

Gaining 1,994 stores / 30d

+8 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

AfterpayArriveCloudflareCloudflare CDNFacebook PixelKlaviyoPayPal Express CheckoutPinterest PixelReChargeRecurpayShineOnTikTok Pixel

Quick answers about Shared Gifts

Figures are estimates from public data — never exact sales or revenue.

Is Shared Gifts a dropshipping store?
Probably. sharedgifts.com is a strong dropshipping match on WHAT Shipping?. We found LAI Product Reviews and Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Shared Gifts get?
An estimated 5K–10K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Shared Gifts sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Shared Gifts sell?
sharedgifts.com lists about 188 products in Gifts & Special Events. Its likely best sellers are To My Daughter - The Proudest Moment, To My Beautiful Daughter, You Are Braver Than You Believe and To My Son - Most Beautiful Chapters.
What apps does Shared Gifts use?
WHAT Shipping? found 16 apps on sharedgifts.com, including Afterpay On‑Site Messaging, Blockify Checkout Customizer, Google & YouTube, Klaviyo: Email Marketing & SMS and LAI Product Reviews App.
How old is Shared Gifts?
sharedgifts.com was created around Oct 18, 2024, about 1 yr 11 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0