Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

L
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

susnfj-jn.myshopify.com

Lara Soler — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with 147 products in the crawled catalogue.

Elegant, modern, you. Dress with intention.

Store catalogue last scanned 2 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
147

~147 products on this store the last time we crawled it — not a live inventory count

Store age
9 mo

Store Leads estimate

Platform confidence90%Store originESFirst crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

bsco.eslarasoler.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Women's Clothing

Features

Shopify New Customer AccountsShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Contact PageTracking or ReturnsTracking PageFree ReturnsHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,935,672
global
Outranks
28.1%
of Shopify stores
Overall rank
#12,622,027
all platforms
Outranks
14.9%
of all tracked stores
Related domains
1
Vendors
1
Collections
12
Location
Valencia, Europe
Subregion
Southern Europe
Theme
dawn (Shopify)
default · vUnknown
Storefront languages
EN
site language
Est. store created
Dec 12, 2025
SL last updated
Sep 18, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (27)

AfterShip Product Reviews

AfterShip Product Reviews

product reviews · design elements - other

Losing 465 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Bundler » Product Bundles App

Bundler » Product Bundles App

product bundles · upsell and cross-sell

Losing 64 stores / 30d

T Lab ‑ AI Language Translate

T Lab ‑ AI Language Translate

currency and translation

Gaining 70 stores / 30d

Essent Cart Drawer Cart Upsell

Essent Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 494 stores / 30d

Consentmo GDPR Compliance

Consentmo GDPR Compliance

cookie consent · accessibility

Gaining 1,934 stores / 30d

Instant Variant Images

Instant Variant Images

product variants · image gallery

Gaining 13 stores / 30d

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Gaining 15,456 stores / 30d

+19 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoKwikGoogle PayKlaviyoMicrosoft ClarityParcelPanelReChargeTikTok Pixelwetracked.io

Quick answers about Lara Soler

Figures are estimates from public data — never exact sales or revenue.

Is Lara Soler a dropshipping store?
Possibly. susnfj-jn.myshopify.com is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Lara Soler sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Lara Soler sell?
susnfj-jn.myshopify.com lists about 147 products in Apparel › Women's Clothing. Its likely best sellers are Claudia - Dress, Nadine - Dress and Alessia - Dress.
What apps does Lara Soler use?
WHAT Shipping? found 27 apps on susnfj-jn.myshopify.com, including AfterShip Product Reviews, BUCKS Currency Converter PRO++, Bundler » Product Bundles App, T Lab ‑ AI Language Translate and Essent Cart Drawer Cart Upsell.
How old is Lara Soler?
susnfj-jn.myshopify.com was created around Dec 12, 2025, about 9 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0