Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

T
Visit store
Open research tabsFree

Free account Β· 2 tabs Β· storefront + best-sellers

thebestnailsusa.com

The Best Nails USA β€” Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated 10K–25K monthly traffic, 231 products in the crawled catalogue.

THE BEST American TPO-FREE nail products by the biggest nail salon chain in USA πŸ’… πŸ† Patented πŸ‡ΊπŸ‡Έ Made in USA 🌎 FREE Worldwide Delivery 🌿 21-FREE BUY NOWπŸ‘‡

Store catalogue last scanned 5 hours ago

Counts and rankings are estimates β€” not exact sales or revenue. How the numbers work

Est. monthly traffic
10K–25K

Estimated range β€” a free account shows the point estimate

Est. sales range
$189K – $352K

Estimated monthly

Est. yearly sales
$2M – $4M

Estimated annualized

Products detected
231

~231 products on this store the last time we crawled it β€” not a live inventory count

Store age
1 yr 6 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match β€” not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.thebestnailsusa.com.

Localised storefronts

The same catalogue served on a country or language domain β€” a merchant running these is already selling in more than one market.

www.thebestnailsusa.com

Other domains pointing here

Domains that redirect or canonicalise to this store β€” same shop, another name.

thebestnailsusa.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals β€” estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads β€” estimates, not a complete audit.

Classification

Categories

Beauty & Fitness β€Ί Face & Body Care β€Ί Skin & Nail Care

Features

Shopify New Customer AccountsFAQ PageInternational ShippingShopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Contact PageSignature RequiredTracking or ReturnsTracking PageWholesale/Retailers Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

USPSUPSFedex
Est. yearly sales
$2M – $4M
estimated annualized
Shopify rank
#518,113
global
Outranks
87.3%
of Shopify stores
Overall rank
#1,762,155
all platforms
Outranks
88.1%
of all tracked stores
Monthly app spend
$50
est.
Related domains
1
Variants
275
Vendors
1
Collections
14
Avg. price (USD)
$29.96
Min price (USD)
$6.90
Max price (USD)
$689.90
Location
Dallas, Americas
Subregion
Northern America
Theme
dawn (Shopify)
default Β· vUnknown
Avg. product weight
18 g
estimated β€” shipping cost proxy
New product images
1
last 30d Β· 96 in 90d
Newest product
launched 257 days ago
Storefront languages
EN
site language
Merchant type
Brand
lists retailers who stock them
Est. store created
Mar 21, 2025
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing β€” worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (7)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking Β· shipping

Gaining 4,633 stores / 30d

UpPromote Affiliate Marketing

UpPromote Affiliate Marketing

affiliate programs Β· loyalty and rewards

Gaining 602 stores / 30d

EG Auto Add to Cart Free Gift

EG Auto Add to Cart Free Gift

cart customization Β· discounts

Gaining 280 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing Β· sms marketing

Gaining 6,161 stores / 30d

Swym Wishlist Plus

Swym Wishlist Plus

wishlists Β· selling in person - other

Gaining 1,249 stores / 30d

Swym Back in Stock Alerts

Swym Back in Stock Alerts

stock alerts Β· email marketing

Gaining 3 stores / 30d

Technologies detected

Estimated technographics β€” not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoDaddy EmailGoogle PayKlaviyoPayPal Express CheckoutShop PaySwym

Quick answers about The Best Nails USA

Figures are estimates from public data β€” never exact sales or revenue.

Is The Best Nails USA a dropshipping store?
Possibly. thebestnailsusa.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does The Best Nails USA get?
An estimated 10K–25K visits a month. This is an estimate from public data, not the store's own analytics.
How much does The Best Nails USA sell?
An estimated $189K – $352K in sales a month ($2M – $4M a year). It is a range estimated from public data, not reported revenue.
What does The Best Nails USA sell?
thebestnailsusa.com lists about 231 products in Beauty & Fitness β€Ί Face & Body Care β€Ί Skin & Nail Care. Its likely best sellers are β€œsuper Strong” Rubber Base Coat, Elite Top Coat and London.
What apps does The Best Nails USA use?
WHAT Shipping? found 7 apps on thebestnailsusa.com, including 17TRACK Order Tracking, UpPromote Affiliate Marketing, EG Auto Add to Cart Free Gift, Shopify Inbox and Klaviyo: Email Marketing & SMS.
How old is The Best Nails USA?
thebestnailsusa.com was created around Mar 21, 2025, about 1 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0