Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

M
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

themurbel.com

MURBEL — Traffic, Sales & Best SellersADAEAFAGAI+211

Possible dropshipping match, with estimated <1K monthly traffic, 416 products in the crawled catalogue.

Discover stylish and protective phone cases at Murbel. Browse a wide collection of trendy designs that keep your phone safe while expressing your personal style. Our high-quality cases combine durability, comfort, and modern fashion, making them perfect for everyday use and a great way to upgrade your phone’s look.

Store catalogue last scanned 2 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$19K – $36K

Estimated monthly

Est. yearly sales
$233K – $432K

Estimated annualized

Products detected
416

~416 products on this store the last time we crawled it — not a live inventory count

Store age
3 yr 5 mo

Store Leads estimate

Platform confidence90%Store originGBPages / visit3.7First crawledJun 26, 2026Last crawled listingSep 28, 2026Last crawledSep 28, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.themurbel.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.themurbel.dewww.themurbel.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

themurbel.de

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Consumer Electronics › Mobile & Wireless › Mobile & Wireless Accessories

Features

Shopify Online Store 2.0International ShippingProduct Page Video TagNew Shopify Checkout (2022)Accepts Gift CardsContact PageTracking or ReturnsReturns PageTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBSBTBWBYBZCACCCFCGCHCICKCLCMCNCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$233K – $432K
estimated annualized
Shopify rank
#262,261
global
Outranks
93.6%
of Shopify stores
Overall rank
#791,070
all platforms
Outranks
94.7%
of all tracked stores
Monthly app spend
$6
est.
Related domains
1
Variants
21,054
Vendors
4
Collections
16
Avg. price (USD)
$38.68
Min price (USD)
$12.00
Max price (USD)
$118.51
Location
London, Europe
Subregion
Northern Europe
Theme
borders (Krown Themes)
borders · v6.5.0 · $380 theme
Trustpilot
3.7 / 5
324 reviews
New product images
834
last 30d · 1,750 in 90d
Newest product
Sep 12, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Apr 7, 2023
SL last updated
Sep 17, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (13)

Clarity Session Replay Heatmap

Clarity Session Replay Heatmap

analytics · site optimization - other

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Magic Zoom Plus

Magic Zoom Plus

images and media - other · design elements - other

Omnisend Email Marketing & SMS

Omnisend Email Marketing & SMS

email marketing · sms marketing

PageFly ✦ AI Page Builder

PageFly ✦ AI Page Builder

page builder · upsell and cross-sell

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Brevo PushOwl: Email,Push,SMS

Brevo PushOwl: Email,Push,SMS

email marketing · sms marketing

Rubik Variant Images & Swatch

Rubik Variant Images & Swatch

product variants · image gallery

+5 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayGoogle WorkspaceMicrosoft ClarityOmnisendParcelPanelPinterest PixelSendinblueTikTok Pixelwetracked.io

Quick answers about MURBEL

Figures are estimates from public data — never exact sales or revenue.

Is MURBEL a dropshipping store?
Possibly. themurbel.com is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does MURBEL get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does MURBEL sell?
An estimated $19K – $36K in sales a month ($233K – $432K a year). It is a range estimated from public data, not reported revenue.
What does MURBEL sell?
themurbel.com lists about 416 products in Consumer Electronics › Mobile & Wireless › Mobile & Wireless Accessories. Its likely best sellers are Lux Screen Protector, Camera Lens Protector and Morning Coffee Club.
What apps does MURBEL use?
WHAT Shipping? found 13 apps on themurbel.com, including Clarity Session Replay Heatmap, Judge.me Product Reviews App, Magic Zoom Plus, Omnisend Email Marketing & SMS and PageFly ✦ AI Page Builder.
How old is MURBEL?
themurbel.com was created around Apr 7, 2023, about 3 yr 5 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0