Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

T
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

thestreetjacket.com

The Street Jacket — Traffic, Sales & Best SellersADAEAGAIAL+205

Possible dropshipping match, with estimated <1K monthly traffic, 2,854 products in the crawled catalogue.

Discover the finest collection of premium leather jackets and coats for men and women at The Street Jacket. Shop now for a touch of timeless sophistication!

Store catalogue last scanned 8 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$5K – $10K

Estimated monthly

Est. yearly sales
$64K – $119K

Estimated annualized

Products detected
2,854

~2,854 products on this store the last time we crawled it — not a live inventory count

Store age
2 yr 10 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

thestreetjacket.co.uk

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.thestreetjacket.co.uk

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Features

FAQ PageShopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageSignature RequiredTracking Page

Markets & shipping

Ships to / sells in

ADAEAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPHPKPLPMPNPTPYQARORSRURWSASCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTLTMTNTRTTTWUAUGUMUSUYUZVCVNXKYEYTZAZMZW

Shipping carriers

FedexUSPSUPS
Est. yearly sales
$64K – $119K
estimated annualized
Shopify rank
#442,093
global
Outranks
89.2%
of Shopify stores
Overall rank
#1,446,286
all platforms
Outranks
90.3%
of all tracked stores
Related domains
2
Variants
26,864
Collections
54
Avg. price (USD)
$118.88
Min price (USD)
$25.00
Max price (USD)
$300.00
Location
Houston, Americas
Subregion
Northern America
Theme
ira (Fluorescent Design Inc.)
street · v2.2.2 · $280 theme
Avg. product weight
1.2 kg
estimated — shipping cost proxy
New product images
457
last 30d · 931 in 90d
Newest product
launched 25 days ago
Storefront languages
EN
site language
Est. store created
Nov 10, 2023
SL last updated
Sep 22, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (7)

UpPromote Affiliate Marketing

UpPromote Affiliate Marketing

affiliate programs · loyalty and rewards

Gaining 642 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 5,653 stores / 30d

CWILL Popup Email Marketing

CWILL Popup Email Marketing

pop-ups · email marketing

Losing 518 stores / 30d

Essent Estimated Delivery Date

Essent Estimated Delivery Date

delivery and pickup · shipping rates

Gaining 351 stores / 30d

Tapita AI SEO Optimizer, Speed

Tapita AI SEO Optimizer, Speed

seo · image editor

Losing 39 stores / 30d

Microsoft Clarity: AI Insights

Microsoft Clarity: AI Insights

analytics · site optimization - other

Gaining 8,034 stores / 30d

Track123 Order Tracking

Track123 Order Tracking

order tracking · shipping

Gaining 1,286 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle AnalyticsGoogle Analytics 4Google PayGoogle Tag ManagerMicrosoft ClarityPinterest PixelShop PayVimeoZoho Mail

Quick answers about The Street Jacket

Figures are estimates from public data — never exact sales or revenue.

Is The Street Jacket a dropshipping store?
Possibly. thestreetjacket.com is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does The Street Jacket get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does The Street Jacket sell?
An estimated $5K – $10K in sales a month ($64K – $119K a year). It is a range estimated from public data, not reported revenue.
What does The Street Jacket sell?
thestreetjacket.com lists about 2,854 products in Apparel. Its likely best sellers are Young Miko Gap Hoodie, GAP x KATSEYE Yoonchae Coachella Hoodie and GAP x KATSEYE Daniela Camo Hoodie.
What apps does The Street Jacket use?
WHAT Shipping? found 7 apps on thestreetjacket.com, including UpPromote Affiliate Marketing, BUCKS Currency Converter PRO++, CWILL Popup Email Marketing, Essent Estimated Delivery Date and Tapita AI SEO Optimizer, Speed.
How old is The Street Jacket?
thestreetjacket.com was created around Nov 10, 2023, about 2 yr 10 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0