Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

M
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

tqcnuy-ew.myshopify.com

Modehealthy — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with 218 products in the crawled catalogue.

Store catalogue last scanned 1 day ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
218

~218 products on this store the last time we crawled it — not a live inventory count

Products moving this week
1

This store's listings in Market Moves · counted 30 Sept

Store age
1 yr 1 mo

Store Leads estimate

Platform confidence90%Store originHKFirst crawledSep 28, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Hextom

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

modehealthy.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Autos & Vehicles › Parts & Services

Tags

Print on Demand

Features

Shopify New Customer AccountsFAQ PageInternational ShippingFree ReturnsShopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsReturns PageTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,808,878
global
Outranks
31.2%
of Shopify stores
Overall rank
#12,495,233
all platforms
Outranks
15.8%
of all tracked stores
Monthly app spend
$30
est.
Related domains
1
Variants
1,362
Vendors
27
Collections
20
Avg. price (USD)
$20.37
Min price (USD)
$6.99
Max price (USD)
$91.95
Location
Hong Kong Disneyland Resort, Asia
Subregion
Eastern Asia
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
Avg. product weight
359 g
estimated — shipping cost proxy
New product images
2,779
last 30d · 2,779 in 90d
Storefront languages
EN
site language
Est. store created
Aug 1, 2025
SL last updated
Sep 25, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (10)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Bundlex Product Bundles Upsell

Bundlex Product Bundles Upsell

product bundles · upsell and cross-sell

Gaining 967 stores / 30d

Customily Product Personalizer

Customily Product Personalizer

print on demand (pod) · custom file upload

Gaining 570 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

Parkour: TikTok Pixel & CAPI

Parkour: TikTok Pixel & CAPI

analytics

Gaining 143 stores / 30d

PreOrder Globo | Back in Stock

PreOrder Globo | Back in Stock

pre-orders · stock alerts

Gaining 836 stores / 30d

Globo Product Options, Variant

Globo Product Options, Variant

product variants · custom products - other

Gaining 256 stores / 30d

Swym Wishlist Plus

Swym Wishlist Plus

wishlists · selling in person - other

Gaining 1,249 stores / 30d

+2 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Adyen Online PaymentsAfterpayApple PayArriveCloudflareCloudflare CDNCustomilyFacebook PixelGoogle Ads PixelGoogle AdsenseGoogle PayKlarnaSnap PixelTikTok PixelVimeo

Quick answers about Modehealthy

Figures are estimates from public data — never exact sales or revenue.

Is Modehealthy a dropshipping store?
Possibly. tqcnuy-ew.myshopify.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK and Hextom installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Modehealthy sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Modehealthy sell?
tqcnuy-ew.myshopify.com lists about 218 products in Autos & Vehicles › Parts & Services. Its likely best sellers are Ends Today: 70% OFF! Modehealthy ADA-Certified Strong Suction Denture, LAST DAY 53% OFF- 24 Days of Highland Cow Advent Calendar and Vacuum Magnetic Suction Car Phone Holder.
What apps does Modehealthy use?
WHAT Shipping? found 10 apps on tqcnuy-ew.myshopify.com, including 17TRACK Order Tracking, Bundlex Product Bundles Upsell, Customily Product Personalizer, Klarna On‑Site Messaging and Parkour: TikTok Pixel & CAPI.
How old is Modehealthy?
tqcnuy-ew.myshopify.com was created around Aug 1, 2025, about 1 yr 1 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0