Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

T
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

trenvioa.com

Trenvioa — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 3 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 2 months ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
3

~3 products on this store the last time we crawled it — not a live inventory count

Store age
3 mo

Store Leads estimate

Platform confidence90%Store originHKFirst crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledJul 5, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.trenvioa.com.

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Face & Body Care › Skin & Nail CareBeauty & Fitness › Face & Body Care › Make-Up & Cosmetics

Tags

Dropshipper

Features

Shopify Online Store 2.0Product Page Video TagNew Shopify Checkout (2022)Free ReturnsContact PageTracking or ReturnsReturns PageTracking PageFAQ Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,556,691
global
Outranks
61.9%
of Shopify stores
Overall rank
#7,032,154
all platforms
Outranks
52.6%
of all tracked stores
Related domains
1
Variants
60
Vendors
2
Collections
1
Avg. price (USD)
$63.23
Min price (USD)
$24.96
Max price (USD)
$159.99
Location
Asia
Subregion
Eastern Asia
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
Avg. product weight
86 g
estimated — shipping cost proxy
New product images
20
last 30d · 50 in 90d
Newest product
launched 14 days ago
Storefront languages
EN
site language
Est. store created
Jun 19, 2026
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (6)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Kaching Bundles App & Upsells

Kaching Bundles App & Upsells

product bundles · upsell and cross-sell

Gaining 4,147 stores / 30d

iCart Cart Drawer Cart Upsell

iCart Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 4,006 stores / 30d

PageFly ✦ AI Page Builder

PageFly ✦ AI Page Builder

page builder · upsell and cross-sell

Gaining 1,994 stores / 30d

OC Meta Pixel‑ Facebook Pixels

OC Meta Pixel‑ Facebook Pixels

ads · analytics

Losing 99 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle PayPayPalPayPal Checkout

Quick answers about Trenvioa

Figures are estimates from public data — never exact sales or revenue.

Is Trenvioa a dropshipping store?
Possibly. trenvioa.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Trenvioa sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Trenvioa sell?
trenvioa.com lists about 3 products in Beauty & Fitness › Face & Body Care › Skin & Nail Care and Beauty & Fitness › Face & Body Care › Make-Up & Cosmetics. Its likely best sellers are Peptide Face & Eye Tape, pimple patch and Skin Restoration Cream.
What apps does Trenvioa use?
WHAT Shipping? found 6 apps on trenvioa.com, including 17TRACK Order Tracking, BUCKS Currency Converter PRO++, Kaching Bundles App & Upsells, iCart Cart Drawer Cart Upsell and PageFly ✦ AI Page Builder.
How old is Trenvioa?
trenvioa.com was created around Jun 19, 2026, about 3 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0