Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

L
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

try-lunara.com

Lunara — Traffic, Sales & Best SellersADAEAFAGAI+212

Possible dropshipping match, with estimated 10K–25K monthly traffic, 59 products in the crawled catalogue.

Store catalogue last scanned 11 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
10K–25K

Estimated range — a free account shows the point estimate

Est. sales range
$144K – $268K

Estimated monthly

Est. yearly sales
$2M – $3M

Estimated annualized

Products detected
59

~59 products on this store the last time we crawled it — not a live inventory count

Store age
2 yr

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.7First crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 29, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Vitals

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.try-lunara.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.try-lunara.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.cozarellastore.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Features

Shopify New Customer AccountsShopify Online Store 2.0International ShippingProduct Page Video TagNew Shopify Checkout (2022)Contact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDOECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$2M – $3M
estimated annualized
Shopify rank
#521,337
global
Outranks
87.2%
of Shopify stores
Overall rank
#1,778,778
all platforms
Outranks
88.0%
of all tracked stores
Monthly app spend
$204
est.
Related domains
1
Variants
655
Vendors
20
Collections
9
Avg. price (USD)
$60.35
Min price (USD)
$3.99
Max price (USD)
$89.99
Location
Cheyenne, Americas
Subregion
Northern America
Theme
trademark (Maestrooo)
gold · v4.1.9 · $180 theme
Trustpilot
4.1 / 5
312 reviews
Avg. product weight
159 kg
estimated — shipping cost proxy
Newest product
launched 209 days ago
Storefront languages
EN
site language
Est. store created
Sep 27, 2024
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (28)

Aris Product Options, Variants

Aris Product Options, Variants

product variants · custom products - other

Losing 385 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Kaching Bundles App & Upsells

Kaching Bundles App & Upsells

product bundles · upsell and cross-sell

Gaining 4,147 stores / 30d

T Lab ‑ AI Language Translate

T Lab ‑ AI Language Translate

currency and translation

Gaining 70 stores / 30d

Depict: Search & Merchandising

Depict: Search & Merchandising

collections · page builder

Gaining 4 stores / 30d

Discount Ninja Promo Engine

Discount Ninja Promo Engine

discounts · upsell and cross-sell

Losing 152 stores / 30d

Simprosys Google Shopping Feed

Simprosys Google Shopping Feed

marketplaces · product feeds

Losing 169 stores / 30d

iCart Cart Drawer Cart Upsell

iCart Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 4,006 stores / 30d

+20 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoKwikGoogle Ads PixelGoogle AdsenseGoogle PayGoogle Tag ManagerGoogle WorkspaceKlaviyoMicrosoft ClarityParcelPanelPayPal Express CheckoutPinterest PixelSezzleShop PaySnap PixelTikTok PixelTriple WhaleTwitter Pixelwetracked.io

Quick answers about Lunara

Figures are estimates from public data — never exact sales or revenue.

Is Lunara a dropshipping store?
Possibly. try-lunara.com is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL and Vitals installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Lunara get?
An estimated 10K–25K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Lunara sell?
An estimated $144K – $268K in sales a month ($2M – $3M a year). It is a range estimated from public data, not reported revenue.
What does Lunara sell?
try-lunara.com lists about 59 products in Apparel. Its likely best sellers are Lunara Sweatpants, Amor Knit Sweater and Lunara Shorts.
What apps does Lunara use?
WHAT Shipping? found 28 apps on try-lunara.com, including Aris Product Options, Variants, BUCKS Currency Converter PRO++, Kaching Bundles App & Upsells, T Lab ‑ AI Language Translate and Depict: Search & Merchandising.
How old is Lunara?
try-lunara.com was created around Sep 27, 2024, about 2 yr ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0