Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

T
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

twinklejewelry.store

Twinkle jewelry — Traffic, Sales & Best SellersADAEAFAGAI+213

New store (<6 months)

Possible dropshipping match, with 926 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 7 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
926

~926 products on this store the last time we crawled it — not a live inventory count

Products moving this week
1

This store's listings in Market Moves · counted 29 Sept

Store age
5 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledSep 7, 2026Last crawled listingSep 28, 2026Last crawledSep 22, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

17guy9-c0.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Clothing Accessories

Features

Shopify New Customer AccountsFAQ PageShopify Online Store 2.0New Shopify Checkout (2022)Tracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,502,511
global
Outranks
63.2%
of Shopify stores
Overall rank
#6,844,371
all platforms
Outranks
53.9%
of all tracked stores
Related domains
1
Vendors
5
Collections
48
Location
Birmingham, Americas
Subregion
Northern America
Theme
horizon (Shopify)
horizon · vUnknown
Storefront languages
EN
site language
Est. store created
Apr 10, 2026
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (2)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

Parkour: Facebook Pixel & Feed

Parkour: Facebook Pixel & Feed

ads · analytics

Gaining 1,160 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle PayPayPal Express CheckoutShopShop Pay

Quick answers about Twinkle jewelry

Figures are estimates from public data — never exact sales or revenue.

Is Twinkle jewelry a dropshipping store?
Possibly. twinklejewelry.store is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Twinkle jewelry sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Twinkle jewelry sell?
twinklejewelry.store lists about 926 products in Apparel › Clothing Accessories. Its likely best sellers are 3D Black Camellia Stud Earrings, Arc de Triomphe Gold Vintage Bracelet and Bow Camellia Earrings.
What apps does Twinkle jewelry use?
WHAT Shipping? found 2 apps on twinklejewelry.store, including 17TRACK Order Tracking and Parkour: Facebook Pixel & Feed.
How old is Twinkle jewelry?
twinklejewelry.store was created around Apr 10, 2026, about 5 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0