Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

V
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

valenneofficial.store

vallenne — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 744 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 20 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
744

~744 products on this store the last time we crawled it — not a live inventory count

Store age
3 mo

Store Leads estimate

Platform confidence90%Store originGBFirst crawledAug 17, 2026Last crawled listingSep 28, 2026Last crawledOct 1, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.valenneofficial.store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.valenneofficial.store

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel

Features

Shopify Online Store 2.0International ShippingProduct Page Video TagNew Shopify Checkout (2022)Free ReturnsContact PageTracking or ReturnsTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW

Shipping carriers

USPSCanada PostAustralia Post
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,174,249
global
Outranks
46.7%
of Shopify stores
Overall rank
#9,556,559
all platforms
Outranks
35.6%
of all tracked stores
Related domains
1
Variants
17,475
Vendors
1
Collections
2
Avg. price (USD)
$43.62
Min price (USD)
$3.00
Max price (USD)
$193.00
Location
London, Europe
Subregion
Northern Europe
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
New product images
2
last 30d · 4,919 in 90d
Newest product
launched 51 days ago
Storefront languages
EN
site language
Est. store created
Jun 26, 2026
SL last updated
Sep 26, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (10)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Kaching Bundles App & Upsells

Kaching Bundles App & Upsells

product bundles · upsell and cross-sell

Gaining 4,147 stores / 30d

Pandectes GDPR Compliance

Pandectes GDPR Compliance

cookie consent · accessibility

Gaining 597 stores / 30d

iCart Cart Drawer Cart Upsell

iCart Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 4,006 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Loox ‑ Product Reviews App

Loox ‑ Product Reviews App

product reviews · social proof

Gaining 1,778 stores / 30d

Section Store: Theme Sections

Section Store: Theme Sections

page builder · storefronts - other

Gaining 274 stores / 30d

+2 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelHotjarNext.jswetracked.io

Quick answers about vallenne

Figures are estimates from public data — never exact sales or revenue.

Is vallenne a dropshipping store?
Possibly. valenneofficial.store is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does vallenne sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does vallenne sell?
valenneofficial.store lists about 744 products in Apparel. Its likely best sellers are R.L Elegant Jacket with Zip - CLEARANCE SALE, R.L Modern Polo Sweatshirt - CLEARANCE SALE and R.L Striped Cotton Dress Shirt.
What apps does vallenne use?
WHAT Shipping? found 10 apps on valenneofficial.store, including 17TRACK Order Tracking, BUCKS Currency Converter PRO++, Kaching Bundles App & Upsells, Pandectes GDPR Compliance and iCart Cart Drawer Cart Upsell.
How old is vallenne?
valenneofficial.store was created around Jun 26, 2026, about 3 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0