Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

V
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

vetrotime.com

Vetro Wear — Traffic, Sales & Best SellersADAEAFAGAI+214

Possible dropshipping match, with estimated <1K monthly traffic, 257 products in the crawled catalogue.

Store catalogue last scanned 1 day ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — a free account shows the point estimate

Est. sales range
$1K – $2K

Estimated monthly

Est. yearly sales
$15K – $28K

Estimated annualized

Products detected
257

~257 products on this store the last time we crawled it — not a live inventory count

Store age
7 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit3.8First crawledJun 27, 2026Last crawled listingOct 4, 2026Last crawledOct 3, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Track123

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

vetro-wear.com

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.vetrotime.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Apparel › Clothing Accessories

Features

Tracking PageProduct Page Video TagNew Shopify Checkout (2022)Free ReturnsContact PageTracking or Returns

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$15K – $28K
estimated annualized
Shopify rank
#1,199,845
global
Outranks
70.6%
of Shopify stores
Overall rank
#5,220,785
all platforms
Outranks
64.7%
of all tracked stores
Monthly app spend
$1
est.
Related domains
2
Variants
625
Vendors
3
Collections
15
Avg. price (USD)
$84.81
Min price (USD)
$0.95
Max price (USD)
$262.95
Location
Kissimmee, Americas
Subregion
Northern America
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
Avg. product weight
186 g
estimated — shipping cost proxy
Newest product
launched 217 days ago
Storefront languages
EN
site language
Est. store created
Feb 6, 2026
SL last updated
Oct 1, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Social media

Installed apps (4)

Avada AI SEO Image Optimizer

Avada AI SEO Image Optimizer

seo · image editor

Losing 264 stores / 30d

BK Reviews

BK Reviews

product reviews

Losing 221 stores / 30d

Section Store: Theme Sections

Section Store: Theme Sections

page builder · storefronts - other

Gaining 274 stores / 30d

Track123 Order Tracking

Track123 Order Tracking

order tracking · shipping

Gaining 1,105 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

ArriveCloudflareCloudflare CDNContentsquareFacebook PixelGoogle Ads PixelGoogle Adsense

Quick answers about Vetro Wear

Figures are estimates from public data — never exact sales or revenue.

Is Vetro Wear a dropshipping store?
Possibly. vetrotime.com is a possible dropshipping match on WHAT Shipping?. We found Track123 installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Vetro Wear get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Vetro Wear sell?
An estimated $1K – $2K in sales a month ($15K – $28K a year). It is a range estimated from public data, not reported revenue.
What does Vetro Wear sell?
vetrotime.com lists about 257 products in Apparel › Clothing Accessories. Its likely best sellers are Case HFSTS 2.0 - Proteja seus Óculos, VETRO Collection V3 – 3 Timepieces + Gift Case and Trappi - Anti Blue Light.
What apps does Vetro Wear use?
WHAT Shipping? found 4 apps on vetrotime.com, including Avada AI SEO Image Optimizer, BK Reviews, Section Store: Theme Sections and Track123 Order Tracking.
How old is Vetro Wear?
vetrotime.com was created around Feb 6, 2026, about 7 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0