Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

V
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

vinolynnsuccess.com

Vino Store — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated 1K–5K monthly traffic, 232 products in the crawled catalogue.

Welcome to Vino, where art meets passion and creativity knows no bounds. Founded by Vincent Ofor, Vino is more than just a brand—it’s a vision brought to life through vibrant colors, bold strokes, and artistic expression.

Store catalogue last scanned 2 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
232

~232 products on this store the last time we crawled it — not a live inventory count

Store age
1 yr 6 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledJun 27, 2026Last crawled listingSep 28, 2026Last crawledSep 26, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

AutoDS

Dropship sourcing / fulfilment

+5

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.vinolynnsuccess.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden › Home Furnishings

Tags

DropshipperPrint on Demand

Features

Shopify Online Store 2.0New Shopify Checkout (2022)Contact PageTracking or ReturnsTracking PageFAQ Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,100,939
global
Outranks
48.5%
of Shopify stores
Overall rank
#9,231,017
all platforms
Outranks
37.8%
of all tracked stores
Monthly app spend
$61
est.
Related domains
1
Variants
367
Vendors
2
Collections
26
Avg. price (USD)
$31.66
Min price (USD)
$5.00
Max price (USD)
$199.80
Location
New Brighton, Americas
Subregion
Northern America
Theme
dwell (Shopify)
dwell · vUnknown
Avg. product weight
113 g
estimated — shipping cost proxy
New product images
596
last 30d · 596 in 90d
Storefront languages
EN
site language
Est. store created
Mar 14, 2025
SL last updated
Sep 26, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (6)

Auto DS: AI Dropshipping & POD

Auto DS: AI Dropshipping & POD

dropshipping · print on demand (pod)

Losing 635 stores / 30d

Doba ‑ AI Dropshipping

Doba ‑ AI Dropshipping

dropshipping

Losing 19 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Instafeed ‑ Instagram Feed

Instafeed ‑ Instagram Feed

social proof · image gallery

Gaining 1,880 stores / 30d

Okendo: Reviews & Loyalty

Okendo: Reviews & Loyalty

product reviews · loyalty and rewards

Gaining 265 stores / 30d

Osaria Audio Player

Osaria Audio Player

animation and effects · images and media - other

Losing 6 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle Ads PixelGoogle AdsenseGoogle PayOkendoPayPal Express CheckoutPinterest PixelShop PayTikTok Pixel

Quick answers about Vino Store

Figures are estimates from public data — never exact sales or revenue.

Is Vino Store a dropshipping store?
Probably. vinolynnsuccess.com is a strong dropshipping match on WHAT Shipping?. We found AutoDS installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Vino Store get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Vino Store sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Vino Store sell?
vinolynnsuccess.com lists about 232 products in Home & Garden › Home Furnishings. Its likely best sellers are Nighttime Support for Relaxation, Rest, and Recovery, Adult Incontinence Pull-Up Underwear and Clear Protein Collagen Peptides.
What apps does Vino Store use?
WHAT Shipping? found 6 apps on vinolynnsuccess.com, including Auto DS: AI Dropshipping & POD, Doba ‑ AI Dropshipping, Shopify Inbox, Instafeed ‑ Instagram Feed and Okendo: Reviews & Loyalty.
How old is Vino Store?
vinolynnsuccess.com was created around Mar 14, 2025, about 1 yr 6 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0