Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

W
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

wondrous.fr

Wondrous — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Strong dropshipping match, with estimated 10K–25K monthly traffic, 342 products in the crawled catalogue, under six months old by Store Leads estimate.

Wondrous, Dudu Bubu, Pinky Purple, Peach Goma, Asamimi, Cartoon, Stitch, Plushies, Pusheen, Clothes, Style, Soso Jojo

Store catalogue last scanned 2 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
10K–25K

Estimated range — a free account shows the point estimate

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
342

~342 products on this store the last time we crawled it — not a live inventory count

Store age
3 mo

Store Leads estimate

Platform confidence90%Store originGBFirst crawledSep 27, 2026Last crawled listingSep 28, 2026Last crawledSep 27, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ali Reviews

AliExpress review importer

+5

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 2 other stores. Their best-ranked storefront is wondrous.ai.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

www.wondrous.fr

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.wondrous.pet

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Tags

DropshipperPrint on Demand

Features

Tracking PageShopify Online Store 2.0New Shopify Checkout (2022)Contact PageInternational ShippingTracking or Returns

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,298,119
global
Outranks
43.7%
of Shopify stores
Overall rank
#10,161,224
all platforms
Outranks
31.5%
of all tracked stores
Related domains
2
Vendors
2
Collections
52
Location
London, Europe
Subregion
Northern Europe
Theme
rise (Shopify)
default · vUnknown
Storefront languages
EN
site language
Est. store created
Jun 19, 2026
SL last updated
Sep 18, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (9)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

AG Product Reviews App & UGC

AG Product Reviews App & UGC

product reviews

Gaining 655 stores / 30d

Ali Reviews: AI Product Review

Ali Reviews: AI Product Review

product reviews · email marketing

Losing 482 stores / 30d

AliReviews: AliExpress Reviews

AliReviews: AliExpress Reviews

product reviews · social proof

Losing 339 stores / 30d

BixGrow Affiliate Marketing

BixGrow Affiliate Marketing

affiliate programs · loyalty and rewards

Gaining 3,735 stores / 30d

Shopify Inbox

Shopify Inbox

chat

Gaining 939 stores / 30d

Klarna On‑Site Messaging

Klarna On‑Site Messaging

banners · advertising - other

Gaining 8,307 stores / 30d

Printify: Print on Demand

Printify: Print on Demand

dropshipping · print on demand (pod)

Gaining 732 stores / 30d

+1 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayKlarnaPayPal Express CheckoutPrintifyShop Pay

Quick answers about Wondrous

Figures are estimates from public data — never exact sales or revenue.

Is Wondrous a dropshipping store?
Probably. wondrous.fr is a strong dropshipping match on WHAT Shipping?. We found Ali Reviews and 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does Wondrous get?
An estimated 10K–25K visits a month. This is an estimate from public data, not the store's own analytics.
How much does Wondrous sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Wondrous sell?
wondrous.fr lists about 342 products. Its likely best sellers are 2/4 PCS Soso Jojo Keychain, SoSo & JoJo Mug and DuduBubu/PeachGoma Wall KeyHolder.
What apps does Wondrous use?
WHAT Shipping? found 9 apps on wondrous.fr, including 17TRACK Order Tracking, AG Product Reviews App & UGC, Ali Reviews: AI Product Review, AliReviews: AliExpress Reviews and BixGrow Affiliate Marketing.
How old is Wondrous?
wondrous.fr was created around Jun 19, 2026, about 3 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0