Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

Y
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

yoyocurated.myshopify.com

YoYo Curated — Traffic, Sales & Best SellersADAEAFAGAI+210

New store (<6 months)

Possible dropshipping match, with 10 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 5 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
10

~10 products on this store the last time we crawled it — not a live inventory count

Store age
1 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledAug 27, 2026Last crawled listingSep 28, 2026Last crawledSep 24, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

6w30rn-au.myshopify.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Fitness

Features

Shopify Online Store 2.0Free ReturnsProduct Page Video TagNew Shopify Checkout (2022)Contact Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,787,754
global
Outranks
31.7%
of Shopify stores
Overall rank
#12,474,109
all platforms
Outranks
15.9%
of all tracked stores
Related domains
2
Vendors
5
Collections
1
Location
Carol Stream, Americas
Subregion
Northern America
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
Storefront languages
EN
site language
Est. store created
Aug 21, 2026
SL last updated
Sep 17, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (2)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

ZT Facebook Pixel TikTok Pixel

ZT Facebook Pixel TikTok Pixel

ads · analytics

Losing 15 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

ArriveCloudflareCloudflare CDNFacebook PixelSnap PixelTikTok Pixel

Quick answers about YoYo Curated

Figures are estimates from public data — never exact sales or revenue.

Is YoYo Curated a dropshipping store?
Possibly. yoyocurated.myshopify.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does YoYo Curated sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does YoYo Curated sell?
yoyocurated.myshopify.com lists about 10 products in Beauty & Fitness › Fitness. Its likely best sellers are Adjustable Hydraulic Arm Trainer | 22-440lbs Foldable, Tiltable, height-adjustable, and movable standing laptop desk and Sit-Up Exercise Equipment, 3-Level Adjustable Ab Crunch Machine Roll-up Machine, Core Trainer for Body Shaping & Muscle Building.
What apps does YoYo Curated use?
WHAT Shipping? found 2 apps on yoyocurated.myshopify.com, including 17TRACK Order Tracking and ZT Facebook Pixel TikTok Pixel.
How old is YoYo Curated?
yoyocurated.myshopify.com was created around Aug 21, 2026, about 1 mo ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0