Free account, everything included: every winning product, Product Search, supplier sourcing and unlimited Shopify imports.

Z
Visit store
Open research tabsFree

Free account · 2 tabs · storefront + best-sellers

zurevn.com

Zurevn — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 5 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 2 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
5

~5 products on this store the last time we crawled it — not a live inventory count

Store age
18 days

Store Leads estimate

Platform confidence90%Store originHKFirst crawledSep 26, 2026Last crawled listingSep 28, 2026Last crawledSep 26, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is www.zurevn.com.

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden › Home Improvement › FlooringHome & Garden › Home Furnishings › Rugs & Carpets

Features

Shopify Online Store 2.0International ShippingNew Shopify Checkout (2022)Free ReturnsContact PageTracking or ReturnsReturns PageTracking PageFAQ Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#1,761,693
global
Outranks
56.8%
of Shopify stores
Overall rank
#7,747,672
all platforms
Outranks
47.8%
of all tracked stores
Related domains
1
Vendors
3
Collections
1
Location
Asia
Subregion
Eastern Asia
Theme
trademark (Maestrooo)
gold · vUnknown · $180 theme
Storefront languages
EN
site language
Est. store created
Sep 11, 2026
SL last updated
Sep 24, 2026

Customer service pages

How this store handles tracking, returns and sizing — worth copying before you launch.

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (5)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

Gaining 4,633 stores / 30d

AppLovin

AppLovin

ads

Gaining 2,743 stores / 30d

BUCKS Currency Converter PRO++

BUCKS Currency Converter PRO++

currency and translation · geolocation

Gaining 4,539 stores / 30d

Kaching Bundles App & Upsells

Kaching Bundles App & Upsells

product bundles · upsell and cross-sell

Gaining 4,147 stores / 30d

iCart Cart Drawer Cart Upsell

iCart Cart Drawer Cart Upsell

cart customization · upsell and cross-sell

Gaining 4,006 stores / 30d

Technologies detected

Estimated technographics — not a complete audit.

AppLovin AXON PixelApple PayArriveCloudflareCloudflare CDNFacebook PixelGoogle PayGoogle Tag ManagerPayPalPayPal CheckoutPinterest PixelSnap PixelSpreedlyTikTok Pixel

Quick answers about Zurevn

Figures are estimates from public data — never exact sales or revenue.

Is Zurevn a dropshipping store?
Possibly. zurevn.com is a possible dropshipping match on WHAT Shipping?. We found 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Zurevn sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Zurevn sell?
zurevn.com lists about 5 products in Home & Garden › Home Improvement › Flooring and Home & Garden › Home Furnishings › Rugs & Carpets. Its likely best sellers are Flash Sale: Deep Joint Relief Patch – Soothe Stiff, Aching Knees, Back & Shoulders, Lash Growth Essence - Safe and Gentle Lash care that makes your lashes thicker and longer within two weeks and Double‑Sided Duct Tape — Strong, Waterproof, Residue‑Free.
What apps does Zurevn use?
WHAT Shipping? found 5 apps on zurevn.com, including 17TRACK Order Tracking, AppLovin, BUCKS Currency Converter PRO++, Kaching Bundles App & Upsells and iCart Cart Drawer Cart Upsell.
How old is Zurevn?
zurevn.com was created around Sep 11, 2026, about 18 days ago, by Store Leads' estimate.

Help us build WHAT Shipping

Beta 1.0.0