Free account: auto-import unlimited products to unlimited Shopify stores, 5 Signal asks, and 5 open picks from today's board.

D
Visit store
Open research tabsPro

Pro only · 2 tabs · storefront + best-sellers

dimyro.com

DAZZLEX – dimyro — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated 1K–5K monthly traffic, 42 products in the crawled catalogue.

Store catalogue last scanned 23 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
1K–5K

Estimated range — subscribers see the point estimate

Est. sales range
$25 – $46

Estimated monthly

Est. yearly sales
$295 – $547

Estimated annualized

Products detected
42

~42 products on this store the last time we crawled it — not a live inventory count

Store age
9 mo

Store Leads estimate

Platform confidence90%Store originUSFirst crawledJun 27, 2026Last crawled listingSep 27, 2026Last crawledSep 27, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

Ryviu

AliExpress review importer

+5

17TRACK

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

www.dimyro.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Finance › Accounting & Auditing

Features

Shopify New Customer AccountsFAQ PageInternational ShippingNew Shopify Checkout (2022)Free ReturnsContact PageTracking or ReturnsReturns PageTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$295 – $547
estimated annualized
Shopify rank
#2,237,287
global
Outranks
44.8%
of Shopify stores
Overall rank
#9,884,738
all platforms
Outranks
33.3%
of all tracked stores
Related domains
1
Variants
277
Vendors
6
Collections
6
Avg. price (USD)
$39.64
Min price (USD)
$18.03
Max price (USD)
$75.70
Location
North Charleston, Americas
Subregion
Northern America
Theme
spotlight (Shopify)
default · vUnknown
Avg. product weight
80 g
estimated — shipping cost proxy
Newest product
Apr 10, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Dec 26, 2025
SL last updated
Sep 17, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (3)

17TRACK Order Tracking

17TRACK Order Tracking

order tracking · shipping

QuickCEP: AI Support Agent

QuickCEP: AI Support Agent

chat · helpdesk

Ryviu: Loyalty & Reviews App

Ryviu: Loyalty & Reviews App

product reviews · loyalty and rewards

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNFacebook PixelTikTok Pixel

Quick answers about DAZZLEX – dimyro

Figures are estimates from public data — never exact sales or revenue.

Is DAZZLEX – dimyro a dropshipping store?
Probably. dimyro.com is a strong dropshipping match on WHAT Shipping?. We found Ryviu and 17TRACK installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does DAZZLEX – dimyro get?
An estimated 1K–5K visits a month. This is an estimate from public data, not the store's own analytics.
How much does DAZZLEX – dimyro sell?
An estimated $25 – $46 in sales a month ($295 – $547 a year). It is a range estimated from public data, not reported revenue.
What does DAZZLEX – dimyro sell?
dimyro.com lists about 42 products in Finance › Accounting & Auditing. Its likely best sellers are Silicone mask cover, ear-mounted fixed mask to moisturize and absorb essence, reusable facial care tool, NEW High-end 30/50PCS Disposable Compressed Facial Mask Portable Non-woven Face Mask Facial Towel Coin Cotton Wrapped Tissues and Fruit-flavored Mask, Hydrating, Moisturizing and Nourishing Skin Care Protein,gently Brightening The Complexion,plant-based Mask.
What apps does DAZZLEX – dimyro use?
WHAT Shipping? found 3 apps on dimyro.com, including 17TRACK Order Tracking, QuickCEP: AI Support Agent and Ryviu: Loyalty & Reviews App.
How old is DAZZLEX – dimyro?
dimyro.com was created around Dec 26, 2025, about 9 mo ago, by Store Leads' estimate.