Free account: auto-import unlimited products to unlimited Shopify stores, 5 Signal asks, and today's top 5 winners.

H
Visit store
Open research tabsPro

Pro only · 2 tabs · storefront + best-sellers

homerelaxofficial.com

HomeRelaxOfficial — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated <1K monthly traffic, 709 products in the crawled catalogue.

Store catalogue last scanned 5 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — subscribers see the point estimate

Est. sales range
$3K – $6K

Estimated monthly

Est. yearly sales
$40K – $73K

Estimated annualized

Products detected
709

~709 products on this store the last time we crawled it — not a live inventory count

Store age
6 yr

Store Leads estimate

Platform confidence90%Store originDEPages / visit3.7First crawledJun 24, 2026Last crawled listingSep 25, 2026Last crawledSep 25, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

EPROLO

Dropship sourcing / fulfilment

+5

Parcel Panel / ParcelWILL

Package tracking

+3

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

homerelaxofficial.myshopify.com

Domain & market

WHOIS domain age is free. Search-demand data comes from the same paid enrichment as SEO depth.

Domain age

5 yrs 290 days

Registered: 10 Sept 2020, 07:33:58 UTC

Expires: 10 Sept 2026, 07:33:58 UTC

Registrar: GoDaddy.com, LLC

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden › Kitchen & Dining › Cookware & Diningware

Tags

DropshipperPrint on Demand

Features

Shopify New Customer AccountsShopify Online Store 2.0Contact PageTracking or ReturnsTracking PageHas Blog

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$40K – $73K
estimated annualized
Shopify rank
#506,831
global
Outranks
87.5%
of Shopify stores
Overall rank
#1,712,774
all platforms
Outranks
88.4%
of all tracked stores
Monthly app spend
$45
est.
Related domains
1
Variants
8,047
Vendors
5
Collections
67
Avg. price (USD)
$108.55
Min price (USD)
$1.00
Max price (USD)
$2,999.00
Location
Mainz, Europe
Subregion
Western Europe
Theme
trademark (Maestrooo)
gold · v12.0.0 · $180 theme
Avg. product weight
14 kg
estimated — shipping cost proxy
Newest product
Mar 15, 2025
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Sep 11, 2020
SL last updated
Sep 16, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (18)

Aftersell Post Purchase Upsell

Aftersell Post Purchase Upsell

upsell and cross-sell · checkout - other

Corner Cart Drawer & Free Gift

Corner Cart Drawer & Free Gift

cart customization · upsell and cross-sell

EPROLO‑Dropshipping & Branding

EPROLO‑Dropshipping & Branding

dropshipping

GOAFFPRO ‑ Affiliate Marketing

GOAFFPRO ‑ Affiliate Marketing

affiliate programs

Simprosys Google Shopping Feed

Simprosys Google Shopping Feed

marketplaces · product feeds

Judge.me Product Reviews App

Judge.me Product Reviews App

product reviews · seo

Klaviyo: Email Marketing & SMS

Klaviyo: Email Marketing & SMS

email marketing · sms marketing

My Easy Monogram

My Easy Monogram

dropshipping · print on demand (pod)

+10 more apps on file

Technologies detected

Estimated technographics — not a complete audit.

ArriveCloudflareCloudflare CDNFacebook PixelGoAffProGoogle AdsenseGoogle AnalyticsJudge.meKlaviyoMicrosoft ClarityOffset EarthParcelPanelPinterest PixelPrintifyShineOnSnap PixelTawkteelaunch

Quick answers about HomeRelaxOfficial

Figures are estimates from public data — never exact sales or revenue.

Is HomeRelaxOfficial a dropshipping store?
Probably. homerelaxofficial.com is a strong dropshipping match on WHAT Shipping?. We found EPROLO and Parcel Panel / ParcelWILL installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does HomeRelaxOfficial get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does HomeRelaxOfficial sell?
An estimated $3K – $6K in sales a month ($40K – $73K a year). It is a range estimated from public data, not reported revenue.
What does HomeRelaxOfficial sell?
homerelaxofficial.com lists about 709 products in Home & Garden › Kitchen & Dining › Cookware & Diningware. Its likely best sellers are Beautiful Resin Cactus Vase, Abstract Nordic Statues and EMS Foot Massager.
What apps does HomeRelaxOfficial use?
WHAT Shipping? found 18 apps on homerelaxofficial.com, including Aftersell Post Purchase Upsell, Corner Cart Drawer & Free Gift, EPROLO‑Dropshipping & Branding, GOAFFPRO ‑ Affiliate Marketing and Simprosys Google Shopping Feed.
How old is HomeRelaxOfficial?
homerelaxofficial.com was created around Sep 11, 2020, about 6 yr ago, by Store Leads' estimate.