Free account: auto-import unlimited products to unlimited Shopify stores, 5 Signal asks, and 5 open picks from today's board.

I
Visit store
Open research tabsPro

Pro only · 2 tabs · storefront + best-sellers

imaginarystyleanddecor.com

imaginarystyleanddecor — Traffic, Sales & Best SellersADAEAFAGAI+214

Strong dropshipping match, with estimated <1K monthly traffic, 511 products in the crawled catalogue.

ImaginaryStyleAndDecor.com brings elegance and creativity to your home. Explore modern décor, stylish accents, and unique furnishings that transform everyday spaces into works of art.

Store catalogue last scanned 4 hours ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. monthly traffic
<1K

Estimated range — subscribers see the point estimate

Est. sales range
$350 – $650

Estimated monthly

Est. yearly sales
$4K – $8K

Estimated annualized

Products detected
511

~511 products on this store the last time we crawled it — not a live inventory count

Store age
11 mo

Store Leads estimate

Platform confidence90%Store originUSPages / visit4.4First crawledJun 27, 2026Last crawled listingSep 7, 2026Last crawledSep 26, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a strong match.

DSers

Dropship sourcing / fulfilment

+5

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

Other domains pointing here

Domains that redirect or canonicalise to this store — same shop, another name.

imaginarystyleanddecor.myshopify.com

Domain & market

WHOIS domain age is free. Search-demand data comes from the same paid enrichment as SEO depth.

Domain age

0 yrs 339 days

Registered: 3 Oct 2025, 23:36:21 UTC

Expires: 3 Oct 2026, 23:36:21 UTC

Registrar: Internet Domain Service BS Corp

Unlock store depth for imaginarystyleanddecor

Social ad creatives, SEO sources, search demand and Meta advertiser depth — the full picture behind this store's numbers.

  • · SEO & traffic source breakdown

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Home & Garden

Tags

Dropshipper

Features

Shopify New Customer AccountsNew Shopify Checkout (2022)

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$4K – $8K
estimated annualized
Shopify rank
#1,348,312
global
Outranks
65.5%
of Shopify stores
Overall rank
#6,183,193
all platforms
Outranks
57.8%
of all tracked stores
Related domains
1
Variants
9,221
Vendors
1
Collections
8
Avg. price (USD)
$141.26
Min price (USD)
$2.99
Max price (USD)
$7,059.99
Location
Fennville, Americas
Subregion
Northern America
Theme
trade (Shopify)
default · vUnknown
Avg. product weight
3.6 kg
estimated — shipping cost proxy
Newest product
May 19, 2026
last product Store Leads saw published
Storefront languages
EN
site language
Est. store created
Oct 24, 2025
SL last updated
Sep 1, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (2)

DSers: Dropship+AliExpress+AI

DSers: Dropship+AliExpress+AI

dropshipping

Pop Convert ‑ Pop Ups, Banners

Pop Convert ‑ Pop Ups, Banners

pop-ups · email marketing

Technologies detected

Estimated technographics — not a complete audit.

Apple PayArriveCloudflareCloudflare CDNGoogle PayPayPal Express CheckoutShop Pay

Quick answers about imaginarystyleanddecor

Figures are estimates from public data — never exact sales or revenue.

Is imaginarystyleanddecor a dropshipping store?
Probably. imaginarystyleanddecor.com is a strong dropshipping match on WHAT Shipping?. We found DSers installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much traffic does imaginarystyleanddecor get?
An estimated <1K visits a month. This is an estimate from public data, not the store's own analytics.
How much does imaginarystyleanddecor sell?
An estimated $350 – $650 in sales a month ($4K – $8K a year). It is a range estimated from public data, not reported revenue.
What does imaginarystyleanddecor sell?
imaginarystyleanddecor.com lists about 511 products in Home & Garden. Its likely best sellers are 320 Gallon Deck Box, Outdoor Large Waterproof Resin Storage Box W/ Lockable Lid, Snoopy Anime Shower Curtain, Bathroom Accessories and 24" Bathroom Vanity Sink Cabinet 2 Drawers Soft-Close Door Storage.
What apps does imaginarystyleanddecor use?
WHAT Shipping? found 2 apps on imaginarystyleanddecor.com, including DSers: Dropship+AliExpress+AI and Pop Convert ‑ Pop Ups, Banners.
How old is imaginarystyleanddecor?
imaginarystyleanddecor.com was created around Oct 24, 2025, about 11 mo ago, by Store Leads' estimate.