Free account: auto-import unlimited products to unlimited Shopify stores, 5 Signal asks, and 5 open picks from today's board.

S
Visit store
Open research tabsPro

Pro only · 2 tabs · storefront + best-sellers

ipeyzu-vr.myshopify.com

Shoprozino — Traffic, Sales & Best SellersADAEAFAGAI+214

New store (<6 months)

Possible dropshipping match, with 84 products in the crawled catalogue, under six months old by Store Leads estimate.

Store catalogue last scanned 6 days ago

Counts and rankings are estimates — not exact sales or revenue. How the numbers work

Est. sales range
$35 – $65

Estimated monthly

Est. yearly sales
$420 – $780

Estimated annualized

Products detected
84

~84 products on this store the last time we crawled it — not a live inventory count

Store age
4 mo

Store Leads estimate

Platform confidence90%Store originHKFirst crawledSep 8, 2026Last crawled listingSep 8, 2026Last crawledSep 22, 2026

Why we flagged this store

App-fingerprint evidence: each dropship-exclusive app detected on the store adds weighted points. This is a signal match — not a confirmation of how the merchant fulfils orders.

This store is a candidate.

Parcel Panel / ParcelWILL

Package tracking

+3

Hextom

CRO bundle

+1

Likely best-selling products

Products

Operator network

Sibling domains Store Leads groups with this merchant (estimated cluster). When one store in a network starts winning, its siblings are worth watching.

This merchant appears to run 1 other store. Their best-ranked storefront is shoprozino.com.

Localised storefronts

The same catalogue served on a country or language domain — a merchant running these is already selling in more than one market.

shoprozino.com

GoogleMetaAdvertising signals

Google Shopping, Meta Ad Library, keyword visibility and Ads Transparency signals — estimated visibility, never exact ad spend.

Store overview

Classification, markets, ranking and product detail from Store Leads — estimates, not a complete audit.

Classification

Categories

Beauty & Fitness › Face & Body Care › Shaving & Hair Removal

Features

Shopify New Customer AccountsInternational ShippingNew Shopify Checkout (2022)Free ReturnsContact PageTracking or ReturnsReturns PageTracking Page

Markets & shipping

Ships to / sells in

ADAEAFAGAIALAMAOARATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBQBRBSBTBWBYBZCACCCFCGCHCICKCLCMCNCOCRCWCXCYCZDEDJDKDMDODZECEEEGERESETFIFJFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGWGYHKHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMEMFMGMLMMMNMOMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPTPYQARORSRURWSASBSCSDSESGSISJSKSLSMSNSOSRSSSTSVSXTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWUAUGUMUSUYUZVCVNVUWFWSXKYEYTZAZMZW
Est. yearly sales
$420 – $780
estimated annualized
Shopify rank
#2,818,622
global
Outranks
27.8%
of Shopify stores
Overall rank
#12,892,468
all platforms
Outranks
11.9%
of all tracked stores
Related domains
2
Vendors
3
Collections
2
Location
Asia
Subregion
Eastern Asia
Theme
publisher (Shopify)
default · vUnknown
Storefront languages
EN
site language
Est. store created
May 29, 2026
SL last updated
Sep 1, 2026

Platform stack

Social profiles, installed apps and technologies Store Leads associates with this storefront.

Installed apps (5)

MG Instagram Feed TikTok Feed

MG Instagram Feed TikTok Feed

social proof · selling online - other

CWILL Order Tracking

CWILL Order Tracking

order tracking · shipping

Swym Wishlist Plus

Swym Wishlist Plus

wishlists · selling in person - other

Omega for your TikTok pixel

Omega for your TikTok pixel

ads · product feeds

Hextom AI Translate & Currency

Hextom AI Translate & Currency

currency and translation · geolocation

Technologies detected

Estimated technographics — not a complete audit.

Adyen Online PaymentsApple PayArriveCloudflareCloudflare CDNGoogle PayParcelPanelTikTok Pixel

Quick answers about Shoprozino

Figures are estimates from public data — never exact sales or revenue.

Is Shoprozino a dropshipping store?
Possibly. ipeyzu-vr.myshopify.com is a possible dropshipping match on WHAT Shipping?. We found Parcel Panel / ParcelWILL and Hextom installed. The match comes from the apps the store runs, not proof of how it fulfils orders.
How much does Shoprozino sell?
An estimated $35 – $65 in sales a month ($420 – $780 a year). It is a range estimated from public data, not reported revenue.
What does Shoprozino sell?
ipeyzu-vr.myshopify.com lists about 84 products in Beauty & Fitness › Face & Body Care › Shaving & Hair Removal. Its likely best sellers are 2-Egg Microwave Poacher, 4-in-1 Massage Shower Head and 50% OFF Reflective Window Spray | One-Way Mirror Privacy Shield for Home & Car.
What apps does Shoprozino use?
WHAT Shipping? found 5 apps on ipeyzu-vr.myshopify.com, including MG Instagram Feed TikTok Feed, CWILL Order Tracking, Swym Wishlist Plus, Omega for your TikTok pixel and Hextom AI Translate & Currency.
How old is Shoprozino?
ipeyzu-vr.myshopify.com was created around May 29, 2026, about 4 mo ago, by Store Leads' estimate.